ESTScan Details for Unigene SGN-U276986

Score 
948
Direction 
Forward
Predicted Peptide Sequence 
MGDAIDLTGDGGVMKKIVQRSKPDAIAPSESLPLVDVHYEGTLADTGEVFDTTREDNTIFSFEIGTGSVIKAWDVALRTMKVGEVAVITC
KPEYAYGSAGSPPDIPPEATLVFEVELVACRPRKGSSVSSASDERARLEELKKQREMAAAAKEEEKKKREEAKAAAAARIQAKLEAKKGK
GKGKAK
Predicted Coding Sequence 
ATGGGTGATGCAATTGATTTAACTGGAGATGGAGGTGTTATGAAGAAAATTGTGCAACGATCCAAACCTGATGCTATTGCTCCCTCAGAG
AGTCTTCCTCTTGTTGATGTTCATTATGAAGGCACTCTTGCTGATACTGGTGAAGTATTTGATACTACCCGTGAAGATAATACAATTTTC
TCCTTTGAGATAGGCACTGGTTCTGTTATTAAGGCTTGGGATGTTGCATTGAGGACCATGAAGGTTGGGGAAGTAGCTGTAATTACCTGC
AAGCCAGAGTATGCCTATGGAAGTGCTGGGTCCCCACCGGATATCCCCCCCGAGGCAACCCTTGTTTTCGAGGTTGAGCTGGTGGCTTGT
AGACCACGTAAAGGTTCTAGTGTCAGCAGCGCTTCAGATGAAAGGGCTAGGCTGGAGGAACTAAAGAAGCAAAGAGAAATGGCAGCTGCA
GCTAAGGAGGAAGAGAAGAAGAAGAGAGAAGAAGCCAAGGCCGCAGCAGCTGCTCGTATCCAAGCCAAACTTGAAGCAAAGAAAGGAAAA
GGGAAGGGCAAAGCGAAGTAA\
Edits in Original Sequence 
CCGAATTCCGATTGATTTTGCCGTCCAATTTCAGATGATACCGGAGTAACCCTCCTCTGCCGTTTAATTTTTTTAATCTCCGGCGAAATT
GAACTGTTGCTGAAAAGTTATATAAC
(5')ATGGGTGATGCAATTGATTTAACTGGAGATGGAGGTGTTATGAAGAAAATTGTGCAACGA
TCCAAACCTGATGCTATTGCTCCCTCAGAGAGTCTTCCTCTTGTTGATGTTCATTATGAAGGCACTCTTGCTGATACTGGTGAAGTATTT
GATACTACCCGTGAAGATAATACAATTTTCTCCTTTGAGATAGGCACTGGTTCTGTTATTAAGGCTTGGGATGTTGCATTGAGGACCATG
AAGGTTGGGGAAGTAGCTGTAATTACCTGCAAGCCAGAGTATGCCTATGGAAGTGCTGGGTCCCCACCGGATATCCCCCCCGAGGCAACC
CTTGTTTTCGAGGTTGAGCTGGTGGCTTGTAGACCACGTAAAGGTTCTAGTGTCAGCAGCGCTTCAGATGAAAGGGCTAGGCTGGAGGAA
CTAAAGAAGCAAAGAGAAATGGCAGCTGCAGCTAAGGAGGAAGAGAAGAAGAAGAGAGAAGAAGCCAAGGCCGCAGCAGCTGCTCGTATC
CAAGCCAAACTTGAAGCAAAGAAAGGAAAAGGGAAGGGCAAAGCGAAGTAA\(3')AAATCGCCATGTATTTATAATATATTTATACACT
AGTAGCATATACTCGTAGATCGTATAGAAATATACCTGATGGTGTTAAATATGCTAACTCGTATTCCTTTTGCTTGATATTTCTAAGATT
TCATATTGTTATAAGTTACCATATGGTTGGGATGGGTTACCTCACTTTAATGGGCAAAGTAATTCAATTTATTTTTGAATTATTTTATAC
AAATGCCTTGGAAGAGAGTATTTTTCGAATTAATCAGACTCTAATGAGAATACCGGACACCATTCGGAAAACCACGAACAAAAATGAAGA
GTAATTGTAATTTTCTTGAAAAAAGACGATGGACAAAACTTTATTCCAAGTACAAGGAAAAATTAACTACTTTAATTTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan