ESTScan Details for Unigene SGN-U277004

Score 
-3
Direction 
Forward
Predicted Peptide Sequence 
MGLQNQLSDISTESIPILMITLFANSLNYLRSLIYTFLQFLGISSSRFTPHQIDDSFCEAVGSGLTGVIFLADQLNLNRLLSYHHQQQND
EKTGADSSTCVVCLNRLGDGDRVXQVSMPARVSHGVFRWVVQYAKFQLSTLPVDLVSGERXGESAAARCWGFTCLVLVKLSVNGRR
Predicted Coding Sequence 
ATGGGATTACAAAACCAGCTTAGTGACATTTCTACTGAATCAATTCCAATATTAATGATAACCCTTTTTGCTAATTCTCTTAATTATCTC
CGTTCCTTAATCTACACTTTCCTTCAATTTCTTGGCATCTCTTCTTCCCGATTTACCCCTCATCAAATCGACGATTCGTTCTGCGAAGCG
GTCGGGTCCGGTTTAACCGGCGTTATTTTCCTCGCCGATCAGCTTAATCTGAACCGTTTGTTATCTTATCATCATCAACAGCAAAATGAT
GAAAAAACCGGTGCCGATTCAAGTACCTGTGTGGTTTGCTTGAACCGGTTGGGTGATGGTGACCGGGTGCXGCAAGTTAGCATGCCGGCA
CGTGTTTCACACGGAGTGTTTAGATGGGTGGTTCAATACGCTAAATTTCAACTGTCCACTTTGCCGGTCGACTTGGTCTCCGGTGAGCGC
GXTGGTGAGAGCGCGGCGGCGCGTTGCTGGGGATTTACTTGCTTGGTTCTCGTTAAACTGAGTGTTAATGGTCGACGATGA\
Edits in Original Sequence 
GCAAATTCTAAAACCATAATAATAGTATCATCCCAAAAT(5')ATGGGATTACAAAACCAGCTTAGTGACATTTCTACTGAATCAATTCC
AATATTAATGATAACCCTTTTTGCTAATTCTCTTAATTATCTCCGTTCCTTAATCTACACTTTCCTTCAATTTCTTGGCATCTCTTCTTC
CCGATTTACCCCTCATCAAATCGACGATTCGTTCTGCGAAGCGGTCGGGTCCGGTTTAACCGGCGTTATTTTCCTCGCCGATCAGCTTAA
TCTGAACCGTTTGTTATCTTATCATCATCAACAGCAAAATGATGAAAAAACCGGTGCCGATTCAAGTACCTGTGTGGTTTGCTTGAACCG
GTTGGGTGATGGTGACCGGGTGCXGCAAGTTAGCATGCCGGCACGTGTTTCACACGGAGTGTTTAGATGGGTGGTTCAATACGCTAAATT
TCAACTGTCCACTTTGCCGGTCGACTTcGGTCTCCGGTGAGCGCGXTGGTGAGAGCGCGGCGGCGCGTTGCTGGGGATTTACTTGCTTGG
TTCTCGTTAAACTGAGTGTTAATGGTCGACGATGA\(3')AAATTAGACTTTTTTTCTTTCTTTTTTTATTTTTCTTTTCACTTTTGTGG
GATTACTTTTAGTTTTTTTTTTTTTAGGAAATTAATATTTTTTTCCTTTTTGTTTTGTTTTTGAAGGGCATTGATAAGAAGCTCTTTTGT
AGCACTTGATAATGATGTAAAAAGGTTTTTGTTTTTGTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan