ESTScan Details for Unigene SGN-U277057

Score 
374
Direction 
Forward
Predicted Peptide Sequence 
MTKNSKAXKKLEAPCACSGTVKFGTGIVFKNGVMKRETQSAEICLQKFEPGYTAPPPKKKAHLVDNNNNNTAAIIRGSGEADIENGRERV
ESDSESEGREMLVMSTQYYECTQAADRSASCCRTIALIFXNSAYDETFVRGDEWRSKKLSLYTSYIANY
Predicted Coding Sequence 
ATGACGAAGAATTCGAAAGCTGXTAAAAAATTAGAAGCTCCATGTGCATGTTCTGGAACTGTAAAGTTTGGCACAGGGATTGTATTCAAA
AATGGTGTAATGAAAAGGGAAACACAATCTGCXGAAATTTGTTTACAGAAATTTGAACCAGGATATACGGCTCCACCTCCTAAGAAGAAG
GCCCACTTGGTTGATAATAATAATAATAATACAGCTGCAATTATTAGAGGAAGTGGAGAAGCAGATATAGAAAATGGAAGGGAAAGAGTA
GAGTCGGATTCAGAATCAGAAGGAAGAGAAATGTTGGTGATGAGTACTCAGTATTATGAATGCACACAAGCTGCCGATAGAAGCGCGTCT
TGCTGTCGAACTATTGCTCTTATCTTCAXCAATTCTGCTTATGATGAGACATTTGTTAGAGGTGATGAATGGAGGAGCAAAAAACTATCC
CTTTACACTTCCTACATTGCTAATTATTAA\
Edits in Original Sequence 
AAAAGAAAGGAAAGAACCAAAAAAAAAAACATTCAAAAGAGATAATATATTTATTTTTTTAAAAAAAAGATTATGAAAAGCAAAACTCAG
ATGGGAGAAGTGATAATATATGTTGATGATTATGAATTTTTCTCTTCTTCAACATATTTATGTAGAATTTGCC
(5')ATGACGAAGAATT
CGAAAGCTGXTAAAAAATTAGAAGCTCCATGTGCATGTTCTGGAACTGTAAAGTTTGcGCACAGGGATTGTATTCAAAAATGGTGTAATG
AAAAGGGAAACACAATCTGCXGAAATTTGTTTACAGAAATTTGAACCAGGATATACGGCTCCACCTCCTAAGAAGAAGGCCCACTTGGTT
GATAATAATAATAATAATACAGCTGCAATTATTAGAGGAAGTGGAGAAGCAGATATAGAAAATGGAAGGGAAAGAGTAGAGTCGGATTCA
GAATCAGAAGGAAGAGAAATGTTGGTGATGAGTACTCAGTATTATGAATGCACACAAGCTGCCGATAGAAGCGCGTCTTGCTGTCGAACT
ATTGCTCTTATCTTCAXCAATTCTGCTTATGATGAGACATTTGTTAGAGGTGATGAATGGAGGAGCAAAAAACTATCCCTTTACACTTCC
TACATTGCTAATTATTAA\(3')ATCCACTGGAATACTCTTGCCCATGTACATTATACTAATGTTAATCACAAGAATTCAGATTATCATT
AGACATCATTATCTGGATTCAGAAGACAGGCTATCCAATTCTGACCAAGACAACTAATACAAGTGTTCAATTTGCATATTCTTTTTCATT
AACAGTGTAATTTTTATTTCTAAGCATCGTACTGATGCTTATCTAATTGTTTTTTTTTTCCATACACGTGGAGAGTAATTAAAAGTTTCA
CAAAAAAGATTCCTTGGTGTTAGTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan