ESTScan Details for Unigene SGN-U277063

Score 
554
Direction 
Forward
Predicted Peptide Sequence 
MAPMVSIATTIVPVTPGAVLLTRRNQCLSKYNVSRKSSKQTLPTPKYILPLSTSIKLFPHFRVGCILRPKLRGLIVSATETDVAVEEVEA
TATDDGSGEVSEASSDAAETSQESSISDVSPTSVQSKRSRPARKSEMPPVKNENLIPGATFTX
Predicted Coding Sequence 
ATGGCTCCAATGGTTTCAATTGCAACTACCATTGTACCAGTTACTCCAGGAGCTGTCCTTCTCACAAGAAGGAATCAATGTTTATCAAAA
TACAATGTTTCACGAAAATCCAGCAAGCAGACTTTACCTACCCCAAAATATATCCTGCCTCTGTCAACATCTATTAAATTGTTTCCCCAT
TTTAGAGTTGGTTGCATTTTACGACCTAAATTAAGAGGTCTTATAGTATCAGCAACTGAGACTGATGTAGCAGTGGAAGAAGTAGAAGCA
ACTGCTACAGATGATGGATCAGGTGAAGTCTCAGAAGCTTCATCTGATGCTGCTGAAACAAGTCAAGAATCCTCCATATCAGATGTGAGT
CCTACATCTGTTCAATCTAAGCGTTCAAGACCTGCTAGAAAGAGTGAGATGCCTCCTGTGAAGAATGAAAACCTTATTCCAGGTGCAACT
TTTACTGXX\
Edits in Original Sequence 
GTGAAGTGTGTGTGAGAGACCCCTATCCCCTCCCTCACCAGCAACAACAACAATAACTTCATTTCAGTTACACTATAGCTCTCTTGTTTC
TTCATATATGCATACAAGCCACCCATTCAAAGGTGTGGAACAGATGATCTAATCCTTGTAGTTCACAAACCTTAGCAATCCCAAATATCA
ATCAAC
(5')ATGGCTCCAATGGTTTCAATTGCAACTACCATTGTACCAGTTACTCCAGGAGCTGTCCTTCTCACAAGAAGGAATCAATG
TTTATCAAAATACAATGTTTCACGAAAATCCAGCAAGCAGACTTTACCTACCCCAAAATATATCCTGCCTCTGTCAACATCTATTAAATT
GTTTCCCCATTTTAGAGTTGGTTGCATTTTACGACCTAAATTAAGAGGTCTTATAGTATCAGCAACTGAGACTGATGTAGCAGTGGAAGA
AGTAGAAGCAACTGCTACAGATGATGGATCAGGTGAAGTCTCAGAAGCTTCATCTGATGCTGCTGAAACAAGTCAAGAATCCTCCATATC
AGATGTGAGTCCTACATCTGTTCAATCTAAGCGTTCAAGACCTGCTAGAAAGAGTGAGATGCCTCCTGTGAAGAATGAAAACCTTATTCC
AGGTGCAACTTTTACTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan