ESTScan Details for Unigene SGN-U277223

Score 
172
Direction 
Forward
Predicted Peptide Sequence 
YFSRHTAPLLRPTAPLLRHTAPLRHLTAPLHLLTAPXSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPSYSPTSPSY
NPSARYSPSLAYSPTSPKLLLLVHTARHLQVTVPHHHRTLQHLHHILLQAQPIVPAAHTTTQVQAQIIVPVLPSTXPSAGYSPSAPGYSP
SSTSQYTPRVSERDNKSVKDDKAG
Predicted Coding Sequence 
XCCTACTTCTCCAGGCATACAGCCCCACTTCTCCGGCCTACAGCCCCACTTCTCCGGCATACAGCCCCACTTCGCCATCTTACAGCCCCA
CTTCACCTTCTTACAGCCCCAXCATCACCTTCATATAGCCCCACCTCACCCTCTTATAGTCCGACTTCTCCATCATATAGTCCGACTTCT
CCTGCATACAGTCCTACCTCCCCTGGTTACAGCCCAACATCTCCCAGCTATAGCCCAACATCACCATCCTACAGTCCTACGTCACCAAGT
TACAATCCCTCGGCGAGATACAGCCCCTCCCTTGCATATTCGCCAACCAGCCCGAAGCTTCTCCTTCTAGTCCATACAGCCCGTCATCTC
CAAGTTACAGTCCCACATCACCATCGTACTCTCCAACATCTCCATCATATTCTCCTTCAAGCCCAACCTATAGTCCCAGCAGCCCATACA
ACAACTCAGGTACAAGCCCAGATTATAGTCCCAGTTCTCCCCAGTACAGXTCCAAGTGCAGGGTACTCACCAAGTGCTCCTGGGTATTCA
CCATCATCTACTAGCCAGTACACCCCGCGTGTAAGTGAGAGAGACAACAAGAGTGTCAAAGATGACAAGGCTGGTTGA\
Edits in Original Sequence 
(5')XCCTACTTCTCCAGGCATACAGCCCCACTTCTCCGGCCTACAGCCCCACTTCTCCGGCATACAGCCCCACTTCGCCATCTTACAGC
CCCACTTCACCTTCTTACAGCCCCAXCATCACCTTCATATAGCCCCACCTCACCCTCTTATAGTCCGACTTCTCCATCATATAGTCCGAC
TTCTCCTGCATACAGTCCTACCTCCCCTGGTTACAGCCCAACATCTCCCAGCTATAGCCCAACATCACCATCCTACAGTCCTACGTCACC
AAGTTACAATCCCTCGGCGAGATACAGCCCCTCCCTTGCATATTCGCCAACCAGCCCGAAGCTgTCTCCTTCTAGTCCATACAGCCCGTC
ATCTCCAAGTTACAGTCCCACATCACCATCGTACTCTCCAACATCTCCATCATATTCTCCTTCAAGCCCAACCTATAGTCCCAGCAGCCC
ATACAACAACTCAGGTACAAGCCCAGATTATAGTCCCAGTTCTCCCCAGTACAGXTCCAAGTGCAGGGTACTCACCAAGTGCTCCTGGGT
ATTCACCATCATCTACTAGCCAGTACACCCCGCGTGTAAGTGAGAGAGACAACAAGAGTGTCAAAGATGACAAGGCTGGTTGA\(3')TC
ATTAGGGAATAAAGTTGTATTTACTTTGAGTGGCTTATTAGTCATTACTGTGCTTTCTGAAGGCGTAAGATTGCTGTATAATATTTTTCG
AAGAATGCAGGTTTTGTTCTAGTTTCTGGGTTTCTCTTTTCCAGTCTAGAATACTTTGGGATTATATAGATGCAGAAAACGTGGTTCCTA
CTTTTTAAGTAGTCTGAGAACTTTGGTGTTTTCGAATAAAAGAAGATTCCAATGGTTAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan