ESTScan Details for Unigene SGN-U277230

Score 
372
Direction 
Forward
Predicted Peptide Sequence 
GDTQGCEDGGNISVRGYQVTNGNGGLTSFVYPSIPQGHPNIRHLPPHIQGVRPQFITLPPQMTASSHRHLPSSSFDSTINPFALVEAGSR
YIRPFPPTAFRLYRPQRGEFMLGTNTRLHNLPNMRVLPEDGVAMLDIPGYHEVRDSVDQHREMRMDVDHMSYEELLALGEQIGTAKTGLS
EEVIVGHLKTRSFSSVEIPCNFGSAACLDHKTDFCVICQSDSKDQENVGTLDCGHEYHAEXRNKLVDSEEQLSHMQVHSTVXQRERIPEN
RRYMISPE
Predicted Coding Sequence 
GGTGATACTCAAGGCTGTGAAGATGGTGGAAACATCAGTGTGCGAGGTTATCAAGTAACAAACGGGAATGGAGGTTTGACTAGTTTTGTA
TATCCATCCATTCCTCAAGGGCACCCAAACATTCGTCATCTACCACCACATATTCAAGGAGTGAGACCCCAATTTATCACTCTCCCTCCA
CAAATGACTGCTTCTTCACACAGACACCTACCAAGTAGCTCGTTTGACAGCACTATCAATCCATTTGCCCTTGTAGAGGCAGGGTCTAGA
TATATTAGACCATTCCCACCGACTGCCTTTAGATTGTACAGACCTCAGCGAGGGGAATTCATGCTTGGAACAAATACTAGACTTCACAAC
CTACCTAACATGAGAGTTCTTCCGGAGGATGGTGTGGCAATGCTGGATATTCCTGGCTATCATGAAGTGCGTGATTCTGTTGATCAGCAC
AGGGAGATGCGAATGGACGTAGATCACATGTCTTATGAGGAGCTTCTTGCATTGGGAGAGCAGATTGGCACTGCAAAAACTGGGTTATCG
GAGGAGGTTATTGTTGGCCATTTGAAAACAAGATCATTTTCCTCTGTAGAAATTCCTTGCAATTTTGGAAGTGCTGCATGTTTAGATCAC
AAGACTGATTTTTGTGTCATATGCCAGTCTGATTCCAAGGACCAAGAGAATGTGGGGACTCTCGATTGTGGGCATGAATATCATGCAGAG
XTGCGTAACAAATTGGTTGATTCTGAAGAACAATTGTCCCATATGCAAGTCCACAGCACTGTGCXGCAGAGGGAAAGGATTCCTGAAAAC
AGGCGATACATGATCTCGCCTGAATGA\
Edits in Original Sequence 
CTCATATTTATTCTACGTGCTAAAAGTTAACTTTGTTTAGCGTGGAATTATTATAAAAGATTCGTGTAGCTATTCAACGAGTTTGGGATT
GATGTAGAGTTGATTTAATTGATTTAAAAGTTAACATTAAGAAATGATTGCATCTCTCTCCTATACTTTATACGTCTTTCGGACAGTTTT
TTAGCCCTTCCTTAAATCTTCAAGGGAAACTTTAGGTCTTTGTAGCGCCACATGTTAACTTCCTAAACTGATTGCATGTCTCTTCTGCTT
TTTTCCCATTACTTTA
(5')GGTGATACTCAAGGCTGTGAAGATGGTGGAAACATCAGTGTGCGAGGTTATCAAGTAACAAACGGGAATG
GAGGTTTGACTAGTTTTGTATATCCATCCATTCCTCAAGGGCACCCAAACATTCGTCATCTACCACCACATATTCAAGGAGTGAGACCCC
AATTTATCACTCTCCCTCCACAAATGACTGCTTCTTCACACAGACACCTACCAAGTAGCTCGTTTGACAGCACTATCAATCCATTTGCCC
TTGTAGAGGCAGGGTCTAGATATATTAGACCATTCCCACCGACTGCCTTTAGATTGTACAGACCTCAGCGAGGGGAATTCATGCTTGGAA
CAAATACTAGACTTCACAACCTACCTAACATGAGAGTTCTTCCGGAGGATGGTGTGGCAATGCTGGATATTCCTGGCTATCATGAAGTGC
GTGATTCTGTTGATCAGCACAGGGAGATGCGAATGGACGTAGATCACATGTCTTATGAGGAGCTTCTTGCATTGGGAGAGCAGATTGGCA
CTGCAAAAACTGGGTTATCGGAGGAGGTTATTGTTGGCCATTTGAAAACAAGATCATTTTCCTCTGTAGAAATTCCTTGCAATTTTGGAA
GTGCTGCATGTTTAGATCACAAGACTGATTTTTGTGTCATATGCCAGTCTGATTCCAAGGACCAAGAGAATGTGGGGACTCTCGATTGTG
GGCATGAATATCATGCAGAGXTGCGTAACAAATTGGTTGATTCTGAAGAACAATTGTCCCATATGCAAGTCCACAGCACTGTGCXGCAGA
GGGAAAGGATTCCTGAAAACAGGCGATACATGATCTCGCCTGAATGA\(3')ATTAAAGAGCAAACATTCTGGATCTGTTGCTAAATATT
TATGCTCCGATGAGTAGGAAACGTTACTGAAACTGTACAAATGTACTGTATTTTTGTATATATATTCGGCATGTTATGACTGACTGTCAA
CATGTCCAAAAACAACTTGTTGGCCTTATCTATGCCATGTGAAAATTCCCGAAAAAAAAAAAACAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan