ESTScan Details for Unigene SGN-U277235

Score 
133
Direction 
Forward
Predicted Peptide Sequence 
HAVAAPRTVDPRAAECTRLACWFDVLFNGSTVPRWLTTAPGAPQLTGISFGGIVTATLCHARTGDNWPLSPVAHKAQSYTIYLTLSATVG
DMLQTSSGKLDLKEPYYRMSQPQAYSSAQEPNQLLQTQDVLTQSWVEDGSVPVQQPSPNHGAXATFTLMVISKSWGVHLDNPLFVLLECL
AKLKESNILMLPSSDPPGVLIACKSLLMCNYLPSFMYDLLSFVSTFYXDHVGCFCIQLDIDGYFICARIQ
Predicted Coding Sequence 
XXTCACGCGGTGGCGGCGCCTAGAACAGTGGATCCCCGGGCTGCAGAATGCACGAGGCTTGCTTGCTGGTTTGATGTACTATTCAATGGA
AGCACTGTACCGAGGTGGCTTACCACTGCTCCTGGTGCACCACAACTCACTGGTATCAGCTTCGGTGGTATTGTCACAGCCACTTTATGT
CATGCCAGGACAGGAGATAACTGGCCACTTTCGCCGGTTGCCCATAAGGCACAAAGTTATACCATTTACCTAACATTGTCAGCTACTGTT
GGAGATATGCTCCAAACGTCCTCTGGAAAACTTGATCTGAAGGAGCCATATTACCGGATGTCCCAACCACAAGCATATTCATCGGCACAA
GAACCAAATCAGCTATTACAAACGCAGGACGTACTAACACAATCTTGGGTTGAAGATGGCTCAGTCCCGGTGCAACAACCTTCTCCAAAT
CATGGCGCTGXAGCTACATTCACTTTGATGGTGATATCCAAGTCATGGGGTGTGCATCTCGATAATCCCCTCTTTGTATTACTAGAGTGC
TTGGCTAAGCTXAAAGAATCCAACATTTTAATGCTGCCAAGTTCTGACCCCCCCGGAGTTTTGATTGCTTGTAAATCGTTGCTCATGTGC
AATTATCTTCCTAGTTTCATGTACGATTTGTTATCTTTCGTTAGCACTTTCTACXCTGACCATGTAGGATGCTTTTGTATCCAGCTTGAT
ATAGATGGCTATTTCATCTGTGCAAGGATCCAATGA\
Edits in Original Sequence 
(5')XXTCACGCGGTGGCGGCGCtCTAGAACAGTGGATCCCCGGGCTGCAGAATcGCACGAGGCTTGCTTGCTGGTTTGATGTACTATTC
AATGGAAGCACTGTACCGAGGTGGCTTACCACTGCTCCTGGTGCACCtACAACTCACTGGTATCAGCTTCGGTGtGTATTGTCACAGCCA
CTTTATGTCATGCCAGGACAGGAGATAACTGGCCACTTTCGCCtGGTTGCCCATAAGGCACAAAGTTATACCATTTACCTAACATTGTCA
GCTACTGTTGGAGATATGCTCCAAACGTCCTCTGGAAAACTTGATCTGAAGGAGCCATATTACCGGATGTCCCAACCACAAGCATATTCA
TCGGCACAAGAACCAAATCAGCTATTACAAACGCAGGACGTACTAACACAATCTTGGGTTGAAGATGGCTCAGTCCCGGTGCAACAACCT
TCTCCAAATCATGGCGCTGXAGCTACATTCACTTTGATGGTGATATCCAAGTCATGGGGTGTGCATCTCGATAATCCCCTCTTTGTATTA
CTAGAGTGCTTGGCTAAGCTXAAAGAATCCAACATTTTAATGCTGCCAAGTTCTGACCCCCCCGGAGTTTTGATTGCTTGTAAATCGTTG
CTCATGTGCAATTATCTTCCTAGTTTCATGTACGATTTGTTATCTTTCGTTAGCACTTTCTACXCTGACCATGTAGGATGCTTTTGTATC
CAGCTTGATATAGATGGCTATTTCATCTGTGCAAGGATCCAATGA\(3')CCCCTCTTTGCCGGATCTACAGGTAAAATGAGTTTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan