ESTScan Details for Unigene SGN-U277316

Score 
869
Direction 
Forward
Predicted Peptide Sequence 
MSTEEENAIEAAAAARRERLRALREAQELLQTPDDDGNKTNEEEDENDVQMKFRNYLPHDKQLQEGKVTPPVLPKFEDPIATLPPPEEKK
EDPFLNIVPKKPNWDLRRDVQKKLDKLEKRTMKALTQLMEEEEKKRKIAEEEDTENGGD
Predicted Coding Sequence 
ATGTCGACGGAGGAGGAAAACGCCATAGAGGCGGCGGCAGCGGCGCGAAGGGAGAGGCTGAGAGCCCTCAGAGAAGCTCAAGAACTTCTT
CAAACCCCTGACGATGATGGTAACAAGACTAACGAAGAGGAAGACGAAAATGATGTCCAAATGAAGTTCCGCAATTACCTGCCACATGAC
AAGCAGCTTCAAGAAGGCAAAGTCACTCCGCCAGTACTCCCAAAGTTCGAAGATCCTATTGCAACTCTACCTCCTCCTGAAGAGAAGAAA
GAGGATCCATTTCTAAATATTGTCCCCAAGAAGCCAAATTGGGACCTGCGACGGGATGTGCAAAAGAAACTTGACAAGCTTGAGAAACGT
ACCATGAAGGCACTCACTCAACTTATGGAGGAAGAAGAAAAAAAGAGGAAGATAGCTGAAGAAGAGGATACTGAAAATGGTGGAGATTAG
\
Edits in Original Sequence 
TTACTCTGCAGAAGCAGAGAGTGTTTTCCATAGTGATTTTGAGTTCGAATTTGGGAAATAGTTTAAAAATATATTGTGA(5')ATGTCGA
CGGAGGAGGAAAACGCCATAGAGGCGGCGGCAGCGGCGCGAAGGGAGAGGCTGAGAGCCCTCAGAGAAGCTCAAGAACTTCTTCAAACCC
CTGACGATGATGGTAACAAGACTAACGAAGAGGAAGACGAAAATGATGTCCAAATGAAGTTCCGCAATTACCTGCCACATGACAAGCAGC
TTCAAGAAGGCAAAGTCACTCCGCCAGTACTCCCAAAGTTCGAAGATCCTATTGCAACTCTACCTCCTCCTGAAGAGAAGAAAGAGGATC
CATTTCTAAATATTGTCCCCAAGAAGCCAAATTGGGACCTGCGACGGGATGTGCAAAAGAAACTTGACAAGCTTGAGAAACGTACCATGA
AGGCACTCACTCAACTTATGGAGGAAGAAGAAAAAAAGAGGAAGATAGCTGAAGAAGAGGATACTGAAAATGGTGGAGATTAG\(3')AT
AGATGTGCAGCAGTAATTCAAAACATTGTGGTTTTGGATAAGACACAAGTGCTGTATGAGTATTATGTTTATTACATCTAGTCTTTTTGA
CTGTGAGACGTTGTAGCGAGTGTTGTGAAGAATATGAATACAGGTTAAATGTCCAAAATACATTCGTAAACTATTGTTAAATACGAGAAT
CATCTGATCTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan