Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U277366

Score 
711
Direction 
Forward
Predicted Peptide Sequence 
SDQSVVAISLGALVHLIEVGGHQFIYNDWDTLLESIRYASYATQPLELLNDLGFENSKHHTTLHNVTENGNGGGHSSDVLDDTHGSQRYA
DLEETGGMPSPSGRSEKPTVLEGLDRSQTIGQKIMGNMMDNRFIRSFTSKPKIQASDILPTSPLKLLADDAEPEAKDEDESSMLATIRSK
CITQLLLLSAIDSIQKKYWNKLKPTHKITIMDILFSVLEFAASYNSYSNLRLRMRQIPAERPPFNLLRQELAGTSIYLDILQKTTAGINS
VREESTETTVAQSGNSFMNNDAASSDMFQEQGSIKEDKIQQIAEEKLVTFCGQVLREASEFQSCTAX
Predicted Coding Sequence 
XXATCTGATCAGTCTGTAGTTGCAATCTCTCTGGGTGCATTGGTCCATCTTATTGAAGTTGGTGGACACCAATTTATTTACAATGATTGG
GATACCTTGCTGGAAAGCATAAGATATGCTTCATACGCAACACAACCCCTTGAGCTTCTGAATGATTTGGGTTTTGAGAACTCAAAGCAT
CACACCACACTGCATAATGTTACTGAAAATGGAAATGGTGGTGGCCATTCATCAGACGTGCTGGACGATACTCATGGATCACAGCGTTAT
GCTGATTTGGAGGAAACTGGAGGTATGCCCTCACCATCTGGGAGATCTGAGAAACCTACGGTTCTAGAAGGTCTTGACCGTAGTCAAACA
ATAGGTCAGAAAATTATGGGAAATATGATGGACAACCGCTTCATCAGAAGTTTCACCTCTAAACCAAAGATTCAGGCTTCTGATATTTTA
CCAACTTCACCGTTAAAGTTATTAGCTGATGATGCGGAGCCTGAAGCAAAAGACGAGGATGAAAGTTCAATGTTGGCTACTATTAGGAGC
AAATGCATCACACAGTTGTTACTTCTCAGTGCAATTGATAGCATTCAGAAGAAATACTGGAACAAGTTAAAACCAACACACAAGATAACT
ATAATGGACATCTTGTTCTCTGTGTTAGAGTTTGCTGCATCATATAATTCGTATTCCAATCTCAGATTGCGGATGCGCCAAATACCTGCT
GAAAGGCCACCATTTAATCTTCTCCGCCAGGAATTAGCAGGAACTTCCATCTATCTTGATATCTTACAGAAGACGACAGCTGGGATCAAT
TCTGTAAGGGAAGAATCAACTGAAACTACCGTTGCTCAGAGTGGAAATAGTTTTATGAATAATGATGCAGCTTCTAGTGATATGTTTCAA
GAGCAGGGATCAATTAAAGAAGATAAGATTCAACAAATTGCAGAAGAGAAACTGGTGACATTTTGTGGACAGGTTCTGAGGGAGGCTTCT
GAGTTCCAGTCCTGCACGGCAGXX\
Edits in Original Sequence 
(5')XXATCTGATCAGTCTGTAGTTGCAATCTCTCTGGGTGCATTGGTCCATCTTATTGAAGTTGGTGGACACCAATTTATTTACAATGA
TTGGGATACCTTGCTGGAAAGCATAAGATATGCTTCATACGCAACACAACCCCTTGAGCTTCTGAATGATTTGGGTTTTGAGAACTCAAA
GCATCACACCACACTGCATAATGTTACTGAAAATGGAAATGGTGGTGGCCATTCATCAGACGTGCTGGACGATACTCATGGATCACAGCG
TTATGCTGATTTGGAGGAAACTGGAGGTATGCCCTCACCATCTGGGAGATCTGAGAAACCTACGGTTCTAGAAGGTCTTGACCGTAGTCA
AACAATAGGTCAGAAAATTATGGGAAATATGATGGACAACCGCTTCATCAGAAGTTTCACCTCTAAACCAAAGATTCAGGCTTCTGATAT
TTTACCAACTTCACCGTTAAAGTTATTAGCTGATGATGCGGAGCCTGAAGCAAAAGACGAGGATGAAAGTTCAATGTTGGCTACTATTAG
GAGCAAATGCATCACACAGTTGTTACTTCTCAGTGCAATTGATAGCATTCAGAAGAAATACTGGAACAAGTTAAAACCAACACACAAGAT
AACTATAATGGACATCTTGTTCTCTGTGTTAGAGTTTGCTGCATCATATAATTCGTATTCCAATCTCAGATTGCGGATGCGCCAAATACC
TGCTGAAAGGCCACCATTTAATCTTCTCCGCCAGGAATTAGCAGGAACTTCCATCTATCTTGATATCTTACAGAAGACGACAGCTGGGAT
CAATTCTGTAAGGGAAGAATCAACTGAAACTACCGTTGCTCAGAGTGGAAATAGTTTTATGAATAATGATGCAGCTTCTAGTGATATGTT
TCAAGAGCAGGGATCAATTAAAGAAGATAAGATTCAACAAATTGCAGAAGAGAAACTGGTGACATTTTGTGGACAGGTTCTGAGGGAGGC
TTCTGAGTTCCAGTCCTGCACGGCAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan