ESTScan Details for Unigene SGN-U277393

Score 
851
Direction 
Forward
Predicted Peptide Sequence 
EDQDEEECRPWRKRLSMAFHWSSLFKFTFLLLLLAAIATACFTLPVEKILKDFLQWIEQDLGPWGPLVLAVAYIPLTVLAVPASVLTLGG
GYLFGLPVGFVADSIGATIGAAAAFLLGRTIGRSFVISKLKDYPQFRAVAIAIRKSGFKIVLLLRLVPLLPFNXAELPVISDTSFNLGIH
AGFMVGNDANNFCPGVFGTTLKDLSDVTHGWGEFSKTRWAMIILGLLVSVFLIICVTRVAKAALEKALAENEDIDDILSIPELPTVADSA
ARLDQPLIIKIDSAQDNHEK
Predicted Coding Sequence 
XCCGAGGACCAAGACGAAGAGGAGTGTAGGCCTTGGCGTAAGAGGTTATCAATGGCTTTTCATTGGTCTTCTCTTTTCAAATTCACTTTT
CTTCTTCTCCTTCTCGCTGCAATTGCCACCGCTTGTTTCACTCTCCCCGTTGAAAAGATACTGAAAGATTTCTTGCAATGGATTGAGCAA
GATCTTGGTCCTTGGGGTCCCCTTGTCCTGGCTGTTGCATACATTCCTCTTACAGTATTGGCAGTTCCTGCATCAGTTCTTACGCTAGGT
GGTGGTTATCTATTTGGCCTGCCTGTGGGTTTTGTTGCTGATTCTATTGGTGCTACCATTGGTGCTGCCGCAGCATTTCTTCTTGGTAGA
ACAATTGGGAGGTCATTTGTCATTTCCAAATTGAAAGATTATCCACAGTTTCGTGCAGTTGCAATTGCAATTCGGAAATCTGGCTTTAAG
ATTGTTTTGCTGCTCCGACTCGTTCCTCTGCTTCCGTTTAATXATGCTGAACTACCTGTTATCAGTGACACCAGTTTCAATTTGGGAATA
CATGCTGGCTTCATGGTTGGGAATGATGCCAATAACTTTTGCCCTGGTGTATTCGGCACAACTTTGAAAGATCTTTCTGATGTTACTCAT
GGATGGGGTGAATTTTCAAAAACTCGCTGGGCTATGATAATATTGGGGCTTTTGGTGTCTGTGTTTTTGATTATTTGTGTGACAAGAGTT
GCAAAGGCCGCTTTAGAAAAAGCACTGGCTGAAAATGAAGACATTGATGACATATTGTCAATACCAGAGCTACCAACTGTGGCTGATTCA
GCTGCACGTCTCGACCAGCCCCTTATAATAAAGATAGATTCTGCTCAAGACAATCATGAAAAATAG\
Edits in Original Sequence 
(5')XCCGAGGACCAAGACGAAGAGGAGTGTAGGCCTTGGCGTAAGAGGTTATCAATGGCTTTTCATTGGTCTTCTCTTTTCAAATTCAC
TTTTCTTCTTCTCCTTCTCGCTGCAATTGCCACCGCTTGTTTCACTCTCCCCGTTGAAAAGATACTGAAAGATTTCTTGCAATGGATTGA
GCAAGATCTTGGTCCTTGGGGTCCCCTTGTCCTGGCTGTTGCATACATTCCTCTTACAGTATTGGCAGTTCCTGCATCAGTTCTTACGCT
AGGTGGTGGTTATCTATTTGGCCTGCCTGTGGGTTTTGTTGCTGATTCTATTGGTGCTACCATTGGTGCTGCCGCAGCATTTCTTCTTGG
TAGAACAATTGGGAGGTCATTTGTCATTTCCAAATTGAAAGATTATCCACAGTTTCGTGCAGTTGCAATTGCAATTCGGAAATCTGGCTT
TAAGATTGTTTTGCTGCTCCGACTCGTTCCTCTGCTTCCGTTTAATXATGCTGAACTACCTGTTATCAGTGACACCAGTTTCAATTTGGG
AATACATGCTGGCTTCATGGTTGGGAATGATGCCAATAACTTTTGCCCTGGTGTATgTCGGCACAACTTTGAAAGATCTTTCTGATGTTA
CTCATGGATGGGGTGAATTTTCAAAAACTCGCTGGGCTATGATAATATTGGGGCTTTTGGTGTCTGTGTTTTTGATTATTTGTGTGACAA
GAGTTGCAAAGGCCGCTTTAGAAAAAGCACTGGCTGAAAATGAAGACATTGATGACATATTGTCAATACCAGAGCTACCAACTGTGGCTG
ATTCAGCTGCACGTCTCGACCAGCCCCTTATAATAAAGATAGATTCTGCTCAAGACAATCATGAAAAATAG\(3')GACTGGTATTATCT
TTGTAAATTTCATACTTGCGCTATGGCTATAGGTATCATTTCTTATTGATGATTTTGGCATCCCTTTGGTGAAGCTTTTTCATAGTCTTC
ATTTGTACAGGCAGATCATACAAATGGACGTAGTTTGGACAGAAATTGAATTATTTAGTTTCTTTTTGGGGCAACTTTAAATCGACGAGT
CTTGGATTACCATTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan