ESTScan Details for Unigene SGN-U277466

Score 
1209
Direction 
Forward
Predicted Peptide Sequence 
MEIMLNNTVLTCASTLLPSTQDGVPLLAVETKVKGDQNTNDEQTKVVDADEEGGDGDDNDENGNEGFEEGEEEYSDEGVHGNNPNKSKGN
AKKSNGEGEENGDAEDEEDGGEEGHDDDGDDDNDDDDDEGDNDDDDGGEGEGEEEEEVVEDDPEDDDEEDEEEETIQPPKKRKKEQMTT
Predicted Coding Sequence 
ATGGAGATCATGCTTAACAACACTGTGCTAACGTGCGCTTCCACGCTTTTACCCTCCACTCAGGATGGTGTGCCACTGTTGGCAGTTGAG
ACCAAAGTCAAGGGAGATCAGAACACAAATGATGAGCAAACCAAAGTAGTTGATGCCGATGAGGAAGGTGGAGATGGAGATGACAACGAT
GAGAATGGAAATGAAGGATTTGAGGAGGGCGAAGAAGAGTATTCTGATGAAGGAGTTCATGGAAACAATCCCAACAAAAGCAAAGGAAAT
GCCAAGAAAAGCAATGGAGAAGGTGAGGAGAATGGAGATGCAGAAGATGAAGAGGATGGTGGTGAAGAAGGTCATGATGATGATGGTGAC
GATGATAATGATGATGACGATGATGAAGGAGATAATGATGACGATGATGGTGGAGAAGGGGAGGGTGAAGAAGAAGAAGAAGTCGTGGAG
GACGATCCAGAAGATGATGATGAAGAGGATGAAGAAGAAGAAACTATCCAACCTCCAAAGAAGAGGAAGAAGGAACAAATGACCACCTGA
\
Edits in Original Sequence 
TAACCAATTCCCATTTTTTCTCTCTCATCTTTCTCAGGTGTCGAGTGGAAAATTAACAGGCAGTACAA(5')ATGGAGATCATGCTTAAC
AACACTGTGCTAACGTGCGCTTCCACGCTTTTACCCTCCACTCAGGATGGTGTGCCACTGTTGGCAGTTGAGACCAAAGTCAAGGGAGAT
CAGAACACAAATGATGAGCAAACCAAAGTAGTTGATGCCGATGAGGAAGGTGGAGATGGAGATGACAACGATGAGAATGGAAATGAAGGA
TTTGAGGAGGGCGAAGAAGAGTATTCTGATGAAGGAGTTCATGGAAACAATCCCAACAAAAGCAAAGGAAATGCCAAGAAAAGCAATGGA
GAAGGTGAGGAGAATGGAGATGCAGAAGATGAAGAGGATGGTGGTGAAGAAGGTCATGATGATGATGGTGACGATGATAATGATGATGAC
GATGATGAAGGAGATAATGATGACGATGATGGTGGAGAAGGGGAGGGTGAAGAAGAAGAAGAAGTCGTGGAGGACGATCCAGAAGATGAT
GATGAAGAGGATGAAGAAGAAGAAACTATCCAACCTCCAAAGAAGAGGAAGAAGtGAACAAATGACCACCTGA\(3')AGTTAGTTTAAC
TTGAGAGGGAGAATCATCCATTATGCTTTTTAATTACCTTTCATTTGAAGTAATTTAGAACTTTGGAGCTTTTATTTGAGCAAACAAGAT
TCTCCCTTCAATTTTTCACATGTCTCTTTACTTAACAAGTCAATTATCACCAATAGTTTCTACTTGCACACAAGAATCATTGATATAATA
CTCAGTTCTGAATAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan