ESTScan Details for Unigene SGN-U277554

Score 
527
Direction 
Forward
Predicted Peptide Sequence 
MPISIIDHQYSTFKNPKNKTHSTPNHQFSNTNDSNVSKNKKKFMSMSFGGLGCKGKLNLPVASTPEVIRSAAQWESSSKQMRNNRRKKMT
TLSTSTRNSTNVVCCAPPGIGSAFDVAPRPKTRSNNKENSRIARRTTNGEAISRSHTSNTRHHCPRFHHRPHIMILRHNLQYDRDIEGDD
QYGSWRLDVDDMSYEQLVELSDKIGYVGTGLEEEKIVEYIRKFKLSXIDSYSMLISTDKSWRCTICQEGYKVDEIGKLECGHYHHIEXHK
EMANA
Predicted Coding Sequence 
ATGCCAATATCAATAATTGATCATCAATATTCAACATTCAAAAATCCAAAAAACAAAACTCATTCTACCCCTAATCATCAATTTTCCAAC
ACAAATGACTCAAATGTATCTAAAAACAAGAAGAAATTTATGTCTATGAGCTTTGGAGGGCTAGGATGTAAGGGAAAATTAAACTTACCG
GTTGCGTCGACGCCGGAAGTTATTAGATCAGCAGCACAATGGGAGAGTAGTAGTAAGCAAATGAGGAATAATAGAAGAAAAAAGATGACA
ACATTGTCAACAAGTACTAGGAATTCAACTAATGTTGTTTGCTGTGCTCCTCCTGGTATTGGTTCTGCTTTTGATGTTGCTCCTAGGCCA
AAAACAAGATCAAATAACAAAGAGAACTCTCGTATCGCGAGGAGAACTACGAATGGTGAAGCAATTTCTAGGTCTCATACGTCTAATACA
AGACATCATTGCCCTCGTTTTCATCATCGTCCTCATATTATGATCCTCAGACACAACTTGCAATATGATAGAGATATAGAAGGGGATGAT
CAATATGGATCTTGGAGACTAGATGTAGATGATATGTCTTATGAGCAATTGGTTGAACTAAGTGATAAAATTGGGTATGTGGGAACAGGT
TTAGAAGAAGAGAAGATAGTTGAATATATAAGAAAGTTTAAGCTCTCAXCAATTGACTCATATTCAATGCTAATATCTACTGATAAAAGT
TGGAGATGTACCATTTGCCAAGAAGGATACAAAGTTGATGAAATTGGAAAACTAGAATGTGGACACTACCATCACATTGAGXTGCATAAA
GAAATGGCTAATGCATAA\
Edits in Original Sequence 
CTAAATTTCATTATTTCTTTAACACA(5')ATGCCAATATCAATAATTGATCATCAATATTCAACATTCAAAAATCCAAAAAACAAAACT
CATTCTACCCCTAATCATCAATTTTCCAACACAAATGACTCAAATGTATCTAAAAACAAGAAGAAATTTATGTCTATGAGCTTTGGAGGG
CTAGGATGTAAGGGAAAATTAAACTTACCGGTTGCGTCGACGCCGGAAGTTATTAGATCAGCAGCACAATGGGAGAGTAGTAGTAAGCAA
ATGAGGAATAATAGAAGAAAAAAGATGACAACATTGTCAACAAGTACTAGGAATTCAACTAATGTTGTTTGCTGTGCTCCTCCTGGTATT
GGTTCTGCTTTTGATGTTGCTCCTAGGCCAAAAACAAGATCAAATAACAAAGAGAACTCTCGTATCGCGAGGAGAACTACGAATGGTGAA
GCAATTTCTAGGTCTCATACGTCTAATACAAGACATCATTGCCCTCGTTTTCATCATCGTCCTCATATTATGATCCTCAGACACAACTTG
CAATATGATAGAGATATAGAAGGGGATGATCAATATGGATCTTGGAGACTAGATGTAGATGATATGTCTTATGAGCAATTGGTTGAACTA
AGTGATAAAATTGGGTATGTGGGAACAGGTTTAGAAGAAGAGAAGATAGTTGAATATATAAGAAAGTTTAAGCTCTCAXCAATTGACTCA
TATTCAATGCTAATATCTACTGATAAAAGTTGGAGATGTACCATTTGCCAAGAAGGATACAAAGTTGATGAAATTGGAAAACTAGAATGT
GGACACTACCATCACATTGAGXTGCATAAAGAAATGGCTAATGCATAA\(3')AAATGTATGTCCTATTTGCAAAATTTCAGCAATCCAT
GAAAATTAATTCTTGACAAAAATTTCTTTCACTTTTCTCTATTTATATTATATAGTCAAGAACATTAAATTTCAGAGGCATAAATTGATT
CTTGGTTTAAACTTTTCCTATTTTTGGTTTGTTAGGAGTGAGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan