ESTScan Details for Unigene SGN-U277723

Score 
713
Direction 
Forward
Predicted Peptide Sequence 
VGFNVKDVAVKDLKAVVFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKN
GDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTGAKVTKAAQKKGK
Predicted Coding Sequence 
XXTGTTGGGTTCAATGTTAAAGATGTTGCTGTTAAGGATCTGAAAGCXGTGGTTTTTGTTGCCTCAAACTCCAAGGATGACCCAGCTAAG
GGGGCAGCCAGTTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCACCAGTGCTCGACTGCCACACT
TCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGAAGGAGCCTAAGTTCTTGAAG
AATGGTGATGCTGGTATGGTTAAGATGATTCCCACTAAGCCCATGGTTGTTGAGACCTTTGCCGAATACCCACCATTGGGTCGTTTCGCT
GTGAGAGACATGAGGCAAACTGTTGCTGTCGGTGTTGTCAAGAATGTTGACAAGAAGGACCCAACTGGTGCCAAGGTCACCAAGGCTGCC
CAGAAGAAGGGAAAGTGA\
Edits in Original Sequence 
(5')XXTGTTGGGTTCAATGTTAAAGaATGTTGCTGTTAAGGATCTGAAAGCXGTGGTTTTTGTTGCCTCAAACTCCAAGGATGACCCAG
CTAAGGGGGCAGCCAGTTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCACCAGTGCTCGACTGCC
ACACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGAAGGAGCCTAAGTTCT
TGAAGAATGGTGATGCTGGTATGGTTAAGATGATTCCCACTAAGCCCATGGTTGTTGAGACCTTTGCCGAATACCCACCATTGGGTCGTT
TCGCTGTGAGAGACATGAGGCAAACTGTTGCTGTCGGTGTTGTCAAGAATGTTGACAAGAAGGACCCAACTGGTGCCAAGGTCACCAAGG
CTGCCCAGAAGAAGGGAAAGTGA\(3')ACAGTGCAGTGTGATGCTAGTGTTTCCAATGCTATTTATTTTCATCAAGTGTGCTATCTAGA
CTCTGTTTTGTTTACTTCTGCTATAGTTTTGTCTTTGATTTGCTTTTTAGGCTCTTGTTTTCTGCCTTGTATGTCATGTAACCATTCTCA
GAACTGGGTACTTGACAGGCGGTGGCAAGCATGATTTGGAGTCTGTTTTCATTCTGTTGAGGTGCCTTGGTTTTCCATGGTGCCTCAGGA
CTTTTTGCTTTTGGTGTTGCCTAAGTTATATTTTATATGAGCTTTTAAATTTCTCTAAAAAAAAAAAAAAAAAAAAAAAACTCGAGACTA
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan