ESTScan Details for Unigene SGN-U277725

Score 
855
Direction 
Forward
Predicted Peptide Sequence 
VXAQPRFSEAFSLPLPKNQGIMGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAXDEQEVIIMNHPGQIGNGYAPV
LDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTGAK
VTKAAPEEGKMKSAFDEHG
Predicted Coding Sequence 
GTTTNTGCGCAGCCAAGGTTTAGCGAAGCTTTCTCTCTTCCACTTCCGAAGAATCAAGGCATTATGGGTAAGGAAAAGATTCACATCAGT
ATTGTGGTCATTGGCCATGTCGACTCTGGAAAGTCCACTACCACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATT
GAGAGGTTTGAGAAGGAAGCTGCTGAXGATGAACAAGAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCACCAGTG
CTCGACTGCCACACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGAAGGAG
CCTAAGTTCTTGAAGAATGGTGATGCAGGTATGGTTAAGATGATTCCCACCAAGCCTATGGTTGTTGAGACCTTTGCTGAGTACCCACCA
TTGGGTCGTTTTGCTGTGAGGGACATGAGGCAAACTGTTGCTGTTGGTGTTGTCAAGAACGTTGACAAGAAGGACCCAACTGGTGCCAAG
GTCACCAAGGCTGCXCCAGAAGAAGGGAAAATGAAGAGTGCATTTGATGAGCACGGATGA\
Edits in Original Sequence 
(5')GTTTNTGCGCAGCCAAGGTTTAGCGAAGCTTTCTCTCTTCCACTTCCGAAGAATCtAAGGCATTATGGGTAAGGAAAAGATTCACA
TCAGTATTGTGGTCATTGGCCATGTCGACTCTGGAAAGTCCACTACCACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTG
TTATTGAGAGGTTTGAGAAGGAAGCTGCTGAXGATGAACAAGAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCAC
CAGTGCTCGACTGCCACACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGA
AGGAGCCTAAGTTCTTGAAGAATGGTGATGCAGGTATGGTTAAGATGATTCCCACCAAGCCTATGGTTGTTGAGACCTTTGCTGAGTACC
CACCATTGGGTCGTTTTGCTGTGAGGGACATGAGGCAAACTGTTGCTGTTGGTGTTGTCAAGAACGTTGACAAGAAGGACCCAACTGGTG
CCAAGGTCACCAAGGCTGCXCCAGAAGAAGGGAAAATGAAGAGTGCATTTGATGAGCACGGATGA\(3')AGTAGTTTTGTTTATTTGCA
TCAGTTTTTTCCAATTTTGTTTTGGACAGCATTTTACCAGTTTTGGATATGGCTACAGAAGGTATTGTCATGGTTCTCTAGCCTCTTTTT
GAGGATAGTGGAGTAATTGAGCAATTTGGTCCTGACCAAATTACTTGATGGGCAATGACATATAGCTCTGGTGGTTGTTCCTTTCCCTGG
TTTTATATCACTTTATAGCCTTGGTCACTGCTTAACTTATTTAACTTGCTGAAATTTCGAGTATATTTTCTTCTCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan