ESTScan Details for Unigene SGN-U277843

Score 
142
Direction 
Forward
Predicted Peptide Sequence 
DYINTAMERLEKNDVRYRFVVDVAGSKLDQ
Predicted Coding Sequence 
XXGGATTATATCAACACTGCAATGGAAAGGTTGGAGAAAAATGATGTGAGGTACAGATTTGTGGTGGATGTTGCCGGAAGCAAGCTTGAC
CAGTAA\
Edits in Original Sequence 
(5')XXGGATTATATCAACACTGCAATGGAAAGGTTGGAGAAAAATGATGTGAGGTACAGATTTGTGGTGGATGTTGCCGGAAGCAAGCT
TGACCAGTAA\(3')TCACATACCAAAAATAAATGGAATTGGGCTGTAATATGAAGAGAAAAATTGAAATACTCAACTTTGATATTGTCA
TCGTTTGTTTTCTTTAATTTGTACTTGTATTTTGTTAATTTTAAATTGTACCTGTATTATCGTGTTTGGTGATTGAATGTTGCAGTTCTG
TACTTTGTTTTCTTCCTTATAAATAAAAAAAAAAACAAAAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
CAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan