ESTScan Details for Unigene SGN-U277920

Score 
808
Direction 
Forward
Predicted Peptide Sequence 
MKGAVTEADAFXSLSSDEEKDGYKVPVFFSFILHSSVLAASSEPYEDKEALLDFLNNVNHTRNLNWDERTSACSSWTGVTCNHDKSRIIA
IRLPGVGFRGSIPGNTLSRLSALQILSLRSNSFSGSLPSDFANLGNLTSIYLQSNNFQGPLPADFSAWKSLSVLNLSNNDFSGSIPSSIS
NLTHLTALVLANNSLSGNIPDLNLPSLQILDLSNNNFTGSIPNSLQRFPGSAFAGNRLSPANFSPSFPPVPPPSVLPKKKSFKLREPAIL
GIVIGGCVLGFLVVAAVLIMCFSKKEGKSGATEKSIKKEDIVRKGVSSSQHGVGNLAFFEGCNLAFDLEDLLRASAEVLGKGTFGTTX
Predicted Coding Sequence 
ATGAAGGGTGCTGTTACTGAAGCTGATGCCTTTGXTAGTTTAAGCTCAGATGAGGAGAAGGATGGCTACAAAGTTCCTGTTTTTTTCAGT
TTTATTCTGCACAGCTCTGTTCTGGCTGCAAGTAGTGAACCATATGAAGACAAAGAAGCGCTTCTTGATTTCCTTAATAATGTTAATCAT
ACCCGAAACCTGAATTGGGATGAGAGAACTTCTGCTTGCAGTTCTTGGACTGGAGTCACCTGTAATCATGACAAATCAAGAATTATAGCA
ATTAGGTTGCCTGGAGTTGGATTCCGTGGTTCGATTCCTGGAAACACTCTTAGCCGCTTGTCTGCTCTTCAGATCTTGAGTTTAAGGTCT
AATAGTTTTAGTGGCAGTTTACCTTCTGATTTTGCAAACCTTGGAAATCTTACTTCTATTTATCTTCAATCCAATAACTTTCAAGGTCCA
TTGCCTGCTGATTTTTCTGCTTGGAAAAGCCTTTCGGTTTTGAATTTGTCAAATAATGATTTTAGTGGGAGTATACCTTCTTCAATATCG
AACTTGACTCATTTGACTGCTCTGGTTCTTGCTAATAACTCGCTTTCTGGCAATATTCCTGATCTCAATCTCCCTAGTTTGCAAATATTA
GATCTATCAAACAATAACTTCACTGGAAGTATCCCCAATTCTCTTCAAAGATTTCCTGGTTCAGCTTTTGCTGGTAACCGGCTTTCTCCT
GCAAATTTTTCACCTTCATTTCCTCCAGTTCCTCCTCCAAGTGTCCTACCGAAAAAGAAATCGTTTAAACTCCGTGAACCTGCAATACTT
GGGATTGTAATTGGAGGATGTGTTTTAGGCTTCTTGGTAGTAGCTGCAGTGCTGATTATGTGCTTTTCGAAGAAAGAGGGTAAAAGTGGG
GCCACAGAGAAATCAATCAAGAAAGAAGATATAGTCAGGAAGGGAGTTTCCAGCAGTCAGCATGGAGTAGGGAATCTCGCATTCTTTGAG
GGTTGTAATCTTGCATTTGACCTTGAAGATCTGTTGAGAGCTTCAGCGGAAGTGCTTGGAAAGGGAACATTTGGCACTACATAX\
Edits in Original Sequence 
CTGGTACTTGCTAGTATACTATACAGTTTCTGAATTTTGTGGGGTTTTCCGTTTTCTCCATTTTGATATGATTTGGCTATCTGGGTATTG
CTATTCAGAG
(5')ATGAAGGGTGCTGTTACTaGAAGCTGATGCCTTTGXTAGTTTAAGCTCAGATGAGGAGAAGGATGGCTACAAAGTT
CCTGTTTTTTTCAGTTTTATTCTGCACAGCTCTGTTCTGGCTaGCAAGTAGTGAACCATATGAAGACAAAGAAGCGCTTCTTGATTTCCT
TAATAATGTTAATCATACCCGAAACCTGAATTGGGATGAGAGAACTTCTGCTTGCAGTTCTTGGACTGGAGTCACCTGTAATCATGACAA
ATCAAGAATTATAGCAATTAGGTTGCCTGGAGTTGGATTCCGTGGTTCGATTCCTGGAAACACTCTTAGCCGCTTGTCTGCTCTTCAGAT
CTTGAGTTTAAGGTCTAATAGTTTTAGTGGCAGTTTACCTTCTGATTTTGCAAACCTTGGAAATCTTACTTCTATTTATCTTCAATCCAA
TAACTTTCAAGGTCCATTGCCTGCTGATTTTTCTGCTTGGAAAAGCCTTTCGGTTTTGAATTTGTCAAATAATGATTTTAGTGGGAGTAT
ACCTTCTTCAATATCGAACTTGACTCATTTGACTGCTCTGGTTCTTGCTAATAACTCGCTTTCTGGCAATATTCCTGATCTCAATCTCCC
TAGTTTGCAAATATTAGATCTATCAAACAATAACTTCACTGGAAGTATCCCCAATTCTCTTCAAAGATTTCCTGGTTCAGCTTTTGCTGG
TAACCGGCTTTCTCCTGCAAATTTTTCACCTTCATTTCCTCCAGTTCCTCCTCCAAGTGTCCTACCGAAAAAGAAATCGTTTAAACTCCG
TGAACCTGCAATACTTGGGATTGTAATTGGAGGATGTGTTTTAGGCTTCTTGGTAGTAGCTGCAGTGCTGATTATGTGCTTTTCGAAGAA
AGAGGGTAAAAGTGGGGCCACAGAGAAATCAATCAAGAAAGAAGATATAGTCAGGAAGGGAGTTTCCAGCAGTCAGCATGGAGTAGGGAA
TCTCGCATTCTTTGAGGGTTGTAATCTTGCATTTGACCTTGAAGATCTGTTGAGAGCTTCAGCGGAAGTGCTTGGAAAGGGAACATTTGG
CACTACATAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan