ESTScan Details for Unigene SGN-U277975

Score 
743
Direction 
Forward
Predicted Peptide Sequence 
VNEINKPPRGKRTRSGVVPPLATRATGAAWPREGVTVPEHSDTSSRQSMHFQVHERGTSGIATSATEEIHPITSGLPSSTTFTTPVYRRE
AQSNFPSTPAVSVPFNRKVTGHTFSSDAASHADDIHMADMTTEGIDVPIRREHNDPVLSSSYSMEVEELLSDVRSDPATPASSRSRGSVR
VSGGSVHNEDVTPDTLSTAAIDIDEIDLVDELX
Predicted Coding Sequence 
GTTAATGAAATAAATAAGCCACCAAGGGGGAAAAGAACAAGGTCTGGAGTGGTTCCTCCTTTGGCAACTAGAGCTACTGGTGCTGCATGG
CCACGAGAAGGTGTTACTGTTCCAGAGCACTCTGATACTTCCTCAAGACAAAGTATGCATTTTCAGGTTCATGAACGAGGAACATCTGGT
ATTGCTACTTCTGCAACTGAAGAAATTCATCCCATTACATCTGGGCTACCATCTTCTACGACATTCACCACTCCTGTTTATAGAAGAGAG
GCTCAATCTAATTTTCCATCTACTCCAGCTGTTTCTGTCCCATTCAATAGGAAGGTTACTGGGCATACCTTTTCATCTGATGCAGCTAGT
CATGCAGATGATATCCATATGGCTGACATGACCACCGAAGGCATTGATGTTCCAATTAGAAGGGAACATAATGACCCTGTCCTTTCATCT
TCTTACTCCATGGAAGTGGAGGAACTTCTGTCAGATGTTAGAAGTGACCCTGCCACACCTGCCAGTAGCAGGAGCAGAGGAAGCGTCCGT
GTCTCTGGCGGTAGTGTCCATAATGAGGATGTAACACCAGATACATTGTCTACTGCAGCAATTGACATTGATGAAATTGATTTGGTTGAT
GAATTGGAX\
Edits in Original Sequence 
(5')GTTAATGAAATAAATAAGCCACCAAGGGGGAAAAGAACAAGGTCTGGAGTGGTTCCTCCTTTGGCAACTAGAGCTACTGGTGCTGC
ATGGCCACGAGAAGGTGTTACTGTTCCAGAGCACTCTGATACTTCCTCAAGACAAAGTATGCATTTTCAGGTTCATGAACGAGGAACATC
TGGTATTGCTACTTCTGCAACTGAAGAAATTCATCCCATTACATCTGGGCTACCATCTTCTACGACATTCACCACTCCTGTTTATAGAAG
AGAGGCTCAATCTAATTTTCCATCTACTCCAGCTGTTTCTGTCCCATTCAATAGGAAGGTTACTGGGCATACCTTTTCATCTGATGCAGC
TAGTCATGCAGATGATATCCATATGGCTGACATGACCACCGAAGGCATTGATGTTCCAATTAGAAGGGAACATAATGACCCTGTCCTTTC
ATCTTCTTACTCCATGGAAGTGGAGGAACTTCTGTCAGATGTTAGAAGTGACCCTGCCACACCTGCCAGTAGCAGGAGCAGAGGAAGCGT
CCGTGTCTCTGGCGGTAGTGTCCATAATGAGGATGTAACACCAGATACATTGTCTACTGCAGCAATTGACATTGATGAAATTGATTTGGT
TGATGAATTGGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan