ESTScan Details for Unigene SGN-U278018

Score 
984
Direction 
Forward
Predicted Peptide Sequence 
KGTLTGSKLVFFFTQFPEPFSKSITGLXRFLGMDEVKKSEGHMTSPAAFVEGGIQDACDDACSICLEAFCESDPPSELAASMSFISSASW
NGVREVLIXPMCWQSISLKDQMSQELFEAVEQERNFRVNAERNATLFHFPGWEILNYSMCVAALKDXAFFFFHLISEVSQASMLCLPXIY
SSFMALQLPVDIDDPELEERILQHLAVAASMGRAHHAGRREGSRNRSSTNHRPQLLVFPTHHNSSPTTSVSPYPTGSISDPAATTTVDSP
LPISSGSSDSPRQMPHLSSVQSDQLSALSSGSVLTPATTQGISSGDRSSSSSSFTPIHRRAGPSELQSFSESWRSRFSSMSMKYKESISK
NTRGWKERLFSRSSSMPDAGPVRRESNAGIASLSHLMERLETRENSRAGSVSAVTNIVDSSHTLQRDHGNMGTHIGNGLNRNSTASAASS
AQN
Predicted Coding Sequence 
XXGAAAGGGACCCTTACCGGTTCAAAATTAGTTTTCTTCTTCACCCAATTTCCGGAGCCTTTTTCTAAATCCATAACAGGTTTGXTAAGG
TTTTTGGGAATGGATGAGGTCAAGAAATCAGAGGGTCATATGACATCACCTGCAGCTTTTGTGGAAGGAGGAATTCAGGATGCATGTGAT
GATGCTTGCAGCATTTGTCTCGAGGCTTTCTGCGAAAGCGATCCTCCCTCGGAACTAGCTGCAAGCATGAGTTTCATCTCCAGTGCGTCC
TGGAATGGTGTCAGAGAAGTTCTAATTGXTCCTATGTGTTGGCAGTCCATAAGTCTGAAAGATCAGATGAGTCAAGAATTGTTTGAGGCT
GTGGAACAAGAAAGGAATTTTAGAGTTAATGCAGAAAGAAATGCTACACTATTTCACTTTCCTGGCTGGGAGATTTTGAACTACAGCATG
TGTGTGGCTGCCTTAAAGGATAXAGCATTTTTCTTTTTTCATCTGATTTCTGAAGTTTCACAAGCTAGCATGTTGTGTTTACCTXCTATT
TATTCTTCATTCATGGCGCTCCAGTTACCTGTGGATATTGATGATCCTGAACTTGAAGAGCGCATTCTTCAGCATTTGGCTGTTGCTGCT
TCAATGGGAAGAGCTCACCATGCGGGTCGAAGGGAGGGCTCAAGAAATCGCTCATCCACCAATCACCGTCCACAACTTTTAGTATTTCCA
ACTCATCATAATTCATCTCCTACCACTTCTGTTTCACCTTATCCTACTGGATCAATTTCTGATCCTGCTGCAACCACAACAGTTGATTCC
CCTCTTCCCATTAGCTCCGGTAGCAGTGATTCACCACGACAGATGCCTCACCTTTCATCAGTTCAAAGTGATCAACTTTCTGCTTTATCA
TCTGGTTCTGTTCTAACGCCTGCCACAACACAAGGAATATCTAGTGGTGATAGAAGCTCTTCTAGTTCATCCTTTACACCAATCCATAGG
AGAGCTGGACCATCAGAGTTGCAGTCATTTTCAGAGTCCTGGAGATCTCGATTTAGTTCTATGTCTATGAAATATAAAGAATCAATCTCA
AAGAATACACGAGGATGGAAGGAGAGATTGTTTTCTCGAAGTTCTTCAATGCCGGATGCTGGTCCTGTTAGGAGAGAGTCAAATGCTGGA
ATTGCTAGTCTATCTCACCTGATGGAACGTCTGGAAACTCGAGAAAATAGTAGAGCTGGCTCTGTTTCAGCAGTTACTAATATAGTGGAT
TCTTCACACACACTCCAAAGAGACCATGGTAATATGGGTACTCATATTGGAAATGGATTGAACAGAAACTCAACAGCTTCTGCTGCAAGT
TCAGCTCAGAATTAA\
Edits in Original Sequence 
(5')XXGAAAGGGACCCTTACCGGTTCAAAATTAGTTTTCTTCTTCACCCAATTTCCGGAGCCTTTTTCTAAATCCATAACAGGTTTGXT
AAGGTTTTTGGGAATGGATGAGGTCAAGAAATCAGAGGGTCATATGACATCACCTGCAGCTTTTGTGGAAGGAGGAATTCAGGATGCATG
TGATGATGCTTGCAGCATTTGTCTCGAGGCTTTCTGCGAAAGCGATCCTCCCTCGGtAACTAGCTGCAAGCATGAGTTTCATCTCCAGTG
CGTCCTGGAATGGTGTCAGAGAAGTTCTAATTGXTCCTATGTGTTGGCAGTCCATAAGTCTGAAAGATCAGATGAGTCAAGAATTGTTTG
AGGCTGTGGAACAAGAAAGGAATTTTAGAGTTAATGCAGAAAGAAATGCTACACTATTTCACTTTCCTGcGCTGGGAGATTTTGAACTAC
AGCATGTGTGTGGCTGCCTTAAAGGATAXAGCATTTTTCTTTTTTCATCTGATTTCTGAAGTTTCACAAGCTAGCATGTTGTGTTTACCT
XCTATTTATTCTTCATTCATGGCGCTCCAGTTACCTGTGGATATTGATGATCCTGAACTTGAAGAGCGCATTCTTCAGCATTTGGCTGTT
GCTGCTTCAATGGGAAGAGCTCACCATGCGGGTCGAAGGGAGGGCTCAAGAAATCGCTCATCCACCAATCACCGTCCACAACTTTTAGTA
TTTCCAACTCATCATAATTCATCTCCTACCACTTCTGTTTCACCTTATCCTACTGGATCAATTTCTGATCCTGCTGCAACCACAACAGTT
GATTCCCCTCTTCCCATTAGCTCCGGTAGCAGTGATTCACCACGACAGATGCCTCACCTTTCATCAGTTCAAAGTGATCAACTTTCTGCT
TTATCATCTGGTTCTGTTCTAACGCCTGCCACAACACAAGGAATATCTAGTGGTGATAGAAGCTCTTCTAGTTCATCCTTTACACCAATC
CATAGGAGAGCTGGACCATCAGAGTTGCAGTCATTTTCAGAGTCCTGGAGATCTCGATTTAGTTCTATGTCTATGAAATATAAAGAATCA
ATCTCAAAGAATACACGAGGATGGAAGGAGAGATTGTTTTCTCGAAGTTCTTCAATGCCGGATGCTGGTCCTGTTAGGAGAGAGTCAAAT
GCTGGAATTGCTAGTCTATCTCACCTGATGGAACGTCTGGAAACTCGAGAAAATAGTAGAGCTGGCTCTGTTTCAGCAGTTACTAATATA
GTGGATTCTTCACACACACTCCAAAGAGACCATGGTAATATGGGTACTCATATTGGAAATGGATTGAACAGAAACTCAACAGCTTCTGCT
GCAAGTTCAGCTCAGAATTAA\(3')GTCTTCTATTTAAGCATTTACCTGGCATCTGTCCTCAGCATTTCATCTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan