ESTScan Details for Unigene SGN-U278109

Score 
285
Direction 
Forward
Predicted Peptide Sequence 
ERLWKLKHSGETNFYLCEINRNMVIDATYKGNKSRYINHSCCPNTEMQRWMIDGETRIGIFATRDIKKGEHLTYDYQFVQFGADQDCHCG
AINCKRKLGIRPNKLKLPSSDAAALKLVACQVAAPFPKEKVLLSAKHDSLTEVPPKGNWSFDSAXENPASSELHRSNYKNNSSSDQSPVD
SLESRIPDVSSSFGIIKQFDSITKKHLIMFEDGSVEHLACQKKIGDFVTLLNQVLSCRNKDIHDSTSVADTRHILTIQNCKVSYSFAPAV
PNVQSFLLTYSLGDNXQFTLPFTGEGSSDDYFRCISTTNVTIAHPVPIISDVP
Predicted Coding Sequence 
GAGCGACTTTGGAAATTGAAGCACAGTGGGGAAACAAATTTTTACTTGTGTGAGATCAATAGGAATATGGTGATTGATGCCACTTATAAG
GGAAACAAATCCAGATACATCAATCATAGCTGTTGTCCAAATACTGAGATGCAGAGATGGATGATTGATGGTGAGACAAGAATTGGCATA
TTTGCGACACGTGACATTAAAAAGGGGGAGCATCTGACCTATGATTATCAGTTTGTTCAATTTGGTGCAGATCAAGATTGTCACTGTGGT
GCTATAAATTGCAAGCGAAAGCTGGGAATCAGACCTAACAAACTAAAACTTCCTTCTTCAGATGCTGCTGCACTAAAGCTAGTGGCATGC
CAGGTAGCTGCGCCCTTTCCCAAAGAGAAAGTACTGCTATCTGCAAAACATGATTCTCTAACTGAGGTTCCCCCAAAAGGAAATTGGAGT
TTTGACTCTGCTXTGGAGAATCCAGCATCCTCGGAATTGCACAGGTCAAATTATAAGAATAATTCCTCTTCTGACCAGAGTCCTGTTGAT
TCACTGGAGTCTCGAATACCCGATGTTTCCAGTTCCTTTGGAATCATAAAACAGTTTGACAGCATCACCAAAAAACATTTGATCATGTTT
GAAGACGGTAGTGTTGAGCACCTTGCTTGTCAAAAGAAGATTGGGGATTTTGTAACTTTGCTTAATCAGGTCTTAAGCTGTCGAAATAAA
GATATACATGATTCAACCTCAGTAGCTGATACGCGACATATTCTTACAATCCAAAATTGCAAAGTGTCCTATAGCTTTGCTCCTGCTGTA
CCAAATGTGCAAAGTTTCCTTTTAACATATTCTTTGGGTGATAATGXTCAGTTCACTCTTCCTTTTACTGGAGAGGGAAGTTCTGATGAT
TATTTCCGATGCATTAGCACAACAAATGTAACAATAGCTCACCCTGTTCCAATTATATCGGATGTCCCCTAA\
Edits in Original Sequence 
(5')GAGCGACTTTGGAAATTGAAGCACAGTGGGGAAACAAATTTTTACTTGTGTGAGATCAATAGGAATATGGTGATTGATGCCACTTA
TAAGGGAAACAAATCCAGATACATCAATCATAGCTGTTGTCCAAATACTGAGATGCAGAGATGGATGATTGATGGTGAGACAAGAATTGG
CATATTTGCGACACGTGACATTAAAAAGGGGGAGCATCTGACCTATGATTATCAGTTTGTTCAATTTGGTGCAGATCAAGATTGTCACTG
TGGTGCTATAAATTGCAAGCGAAAGCTGGGAATCAGACCTAACAAACTAAAACTTCCTTCTTCAGATGCTGCTGCACTAAAGCTAGTGGC
ATGCCAGGTAGCTGCGCCCTTTCCCAAAGAGAAAGTACTGCTATCTGCAAAACATGATTCTCTAACTGAGGTTCCCCCAAAAGGAAATTG
GAGTTTTGACTCTGCTXTGGAGAATCCAGCATCCTCGGAATTGCACAGGTCAAATTATAAGAATAATTCgCTCTTCTGACCAGAGTCCTG
TTGATTCACTGGAGTCTCGAATACCCGATGTTTCCAGTTCCTTTGGAATCATAAAACAGTTTGACAGCATCACCAAAAAACATTTGATCA
TGTTTGAAGACGGTAGTGTTGAGCACCTTGaCTTGTCAAAAGAAGATTGGGGATTTTGTAACTTTGCTTAATCAGGTCTTAAGCTGTCGA
AATAAAGATATACATGATTCAACCTCAGTAGCTGATACGCGACATATTCTTACAATCCAAAATTGCAAAGTGTCCTATAGCTTTGCTCCT
GCTGTACCAAATGTGCAAAGTTTCCTTTTAACATATTCTTTcGGGTGATAATGXTCAGTTCACTCTTCCTTTTACTGGAGAGGGAAGTTC
TGATGATTATTTCCGATGCATTAGCACAACAAATGTAACAATAGCTCACCCTGTTCCAATTATATCGGATGTCCCCTAA\(3')GAAACA
TGTTGACTCTGTGGATCATAATTTATTTACTAGTCGTAAAGATGGATTTGTTAGCTCTCGATTTTCGTGTGTAGTTGAGGATTCAAATAG
CCGATCCCAACTTGCTTGGGATTGTGGTATAGTCCTTGTTATGTTCTTATTCAATGCACTCTTTTGGCCTCCAAAAGAATATTTGTTTCN
CAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan