ESTScan Details for Unigene SGN-U278128

Score 
600
Direction 
Forward
Predicted Peptide Sequence 
MASAALSVANSSVHVSNNKGSFSEFTGLRTSSAVPFGVGRKINDDLLSLVAFQTSVIGGGKKNNSRVVEAKLKVAINLFGRFGRNFLRCC
HGMKDSSLDVIAINDSGGVMQASHLLKYESTLGIFDADVKPVGTDGISVDGKLIKAVSAVTPSISPGRSGGIDSHPRG
Predicted Coding Sequence 
ATGGCTTCGGCTGCTCTATCAGTAGCCAATTCTTCTGTCCACGTTAGCAACAATAAAGGATCATTCTCAGAGTTCACTGGCCTTCGAACC
TCATCTGCCGTTCCATTCGGAGTCGGAAGGAAAATTAACGATGACTTGCTATCTCTTGTTGCTTTCCAAACCTCTGTTATTGGTGGAGGA
AAAAAGAATAATAGTAGAGTAGTGGAGGCAAAATTGAAGGTAGCCATCAATTTATTTGGAAGATTTGGAAGGAATTTCTTGAGGTGCTGC
CATGGCATGAAGGACTCTTCCCTTGATGTCATTGCCATCAATGACTCTGGCGGTGTCATGCAAGCCTCTCACCTCCTCAAGTACGAATCT
ACCCTCGGCATCTTCGATGCTGATGTTAAGCCTGTTGGTACTGATGGCATCTCTGTTGATGGAAAGCTCATCAAAGCCGTCTCCGCCGTA
ACCCCATCAATCTCCCCTGGAAGGTCCGGCGGTATCGACTCTCATCCCCGTGGCTAG\
Edits in Original Sequence 
CAAAAATCA(5')ATGGCTTCGGCTGCTCTATCAGTAGCCAATTCTTCTGTCCACGTTAGCAACAATAAAGGATCATTCTCAGAGTTCAC
TGGCCTTCGAACCTCATCTGCCGTTCCATTCGGAGTCGGAAGGAAAATTAACGATGACTTGCTATCTCTTGTTGCTTTCCAAACCTCTGT
TATTGGTGGAGGAAAAAAGAATAATAGTAGAGTAGTGGAGGCAAAATTGAAGGTAGCCATCAATTTATTTGGAAGATTTGGAAGGAATTT
CTTGAGGTGCTGCCATGGCATGAAGGACTCTTCCCTTGATGTCATTGCCATCAATGACTCTGGCGGTGTCATGCAAGCCTCTCACCTCCT
CAAGTACGAATCTACCCTCGGCATCTTCGATGCTGATGTTAAGCCTGTTGGTACTGATGGCATCTCTGTTGATGGAAAGCTCATCAAAGC
CGTCTCCGaCCGTAACCCCATCAATCTCCCCTGGAAGGTCCGGCGGTATCGACTCTCATCCCCGTGGCTAG\(3')GATCTTTGTAGAGC
AAGAATTGAAGATTGGTGATTCCTTAGTGTATTCGAGGATATGGCCACCATTTCTCTTATGTTCTTTCATTTTATTTTTTGAACACTATT
GTATGGATTATATCCCAAGANTATTCATGTTTTAAATGGTTTGAGACAGTGTAATAGACTTCTGCTTTTGATAAAAAAAAAGAAAAAAAA
AAACTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan