ESTScan Details for Unigene SGN-U278198

Score 
664
Direction 
Forward
Predicted Peptide Sequence 
FLSLHTVYKPSSFLDGLQLGLKGSGFVQGRTCEGCQVGAIHTGATDAGSQFGLEELLVFAQIXGGGFIEELDDMVGTRSNIEADPHFGLM
DPFPDPRFGIMDALAAFMRQRMAGRNPNFDIRTRSGVVPGSGRGFGSGPWLIFHGQTPVSMTENDAFEYFFSNGSPRMGHRRPNFDDLMG
PGLQQLIEQLSMNDRQGPPPAPRSAIDALPTAESLKGTSTLILSAQFVKITLNWVLKQGKCHVSIFTIQIVSYHGWLGTTHALFAVLNWP
HKLLRVPQPIGVPELETLAVAVTIVAGRIAVRTX
Predicted Coding Sequence 
XATTTTCTCTCACTCCACACTGTCTACAAACCATCATCXTTCTTGGATGGTCTGCAGCTTGGTCTAAAAGGTTCAGGATTTGTTCAAGGA
CGTACTTGTGAGGGATGTCAAGTGGGAGCTATACACACTGGTGCCACAGATGCAGGCAGCCAATTCGGCCTCGAGGAACTACTTGTCTTT
GCCCAAATTGXTGGTGGAGGTTTCATTGAAGAGCTCGATGACATGGTAGGTACTAGATCTAATATTGAGGCTGATCCTCATTTTGGATTG
ATGGATCCTTTCCCGGACCCAAGATTTGGTATAATGGATGCCCTTGCTGCATTCATGAGGCAGAGAATGGCAGGAAGAAACCCAAACTTT
GACATTAGGACAAGATCTGGTGTTGTTCCTGGAAGTGGGAGGGGTTTTGGTTCTGGTCCATGGCTGATATTTCATGGCCAAACTCCTGTT
AGTATGACTGAAAACGATGCATTTGAGTACTTTTTCTCCAATGGAAGCCCACGAATGGGGCATCGGCGACCTAATTTTGATGATTTGATG
GGGCCTGGTCTGCAACAGTTAATTGAGCAGCTCAGTATGAATGACCGGCAGGGGCCTCCCCCAGCACCTCGTTCTGCAATAGATGCTTTG
CCTACTGCAGAATCACTCAAAGGCACCTCAACGTTGATTCTCAGTGCTCAGTTTGTCAAGATAACTTTGAATTGGGTTCTGAAGCAAGGG
AAATGCCATGTAAGCATCTTTACCATTCAGATTGTATCGTACCATGGTTGGTTAGGCACAACTCATGCCCTGTTTGCCGTCTTGAACTGG
CCTCACAAGCTTCTGCGAGTGCCCCAGCCAATTGGAGTACCAGAACTGGAAACGTTAGCAGTGGCAGTAACAATAGTAGCAGGGAGAATA
GCAGTCCGAACCAAX\
Edits in Original Sequence 
(5')XATTTTCTCTCACTCCACACTGTCTACAAACCATCATCXTTCTTGGATGGTCTGCAGCTTGGTCTAAAAGGTTCAGGATTTGTTCA
AGGACGTACTTGTGAGGGATGTCAAGTGGGAGCTATACACACTGGTGCCACAGATGCAGGCAGCCAATTCGGCCTCGAGGAACTACTTGT
CTTTGCCCAAATTGXTGGTGGAGGTTTCATTGAAGAGCTCGATGACATGGTAGGTACTAGATCTAATATTGAGGCTGATCCTCATTTTGG
ATTGATGGATCCTTTCCCGGACCCAAGATTTGGTATAATGGATGCCCTTGCTGCATTCATGAGGCAGAGAATGGCAGGAAGAAACCCAAA
CTTTGACATTAGGACAAGATCTGGTGTTGTTCCTGGAAGTGGGAGGGGTTTTGGTTCTGGTCCATGGCTGATATTTCATGGCCAAACTCC
TGTTAGTATGACTGAAAACGATGCATTTGAGTACTTTTTCTCCAATGGAAGCCCACGAATGGGGCATCGGCGACCTAATTTTGATGATTT
GATGGGGCCTGGTCTGCAACAGTTAATTGAGCAGCTCAGTATGAATGACCGGCAGGGGCCTCCCCCAGCACCTCGTTCTGCAATAGATGC
TTTGCCTACTGtCAGAATCACTCAAAGGCACCTCAACGTTGATTCTCAGTGCTCAGTTTGTCAAGATAACTTTGAATTGGGTTCTGAAGC
AAGGGAAATGCCATGTAAGCATCTTTACCATTCAGATTGTATCGTACCATGGTTGGTTAGGCACAACTCATGCCCTGTTTGCCGTCTTGA
ACTGGCCTCACAAGCTTCTGCGAGTGCCCCAGCCAATTGGAGTACCAGAACTGGAAACGTTAGCAGTGGCAGTAACAATAGTAGCAGGGA
GAATAGCAGTCCGAACCAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan