ESTScan Details for Unigene SGN-U278265

Score 
473
Direction 
Forward
Predicted Peptide Sequence 
EHDICSSRQQGVTEKVXASWLAWAQLEAQLENNRTARQLFEKAVQASPKNRFAWHVWGVFEANLGNIDQGRKLLTIGHMMNPRDPXPPPV
TWFDRIQELQCKPCTSSIPKGISTGSKAPPVWIAWGWMEWKEGNISTARELYQKALSINSTTESAARCLQAWGVLEQRAGNLSAARRLFR
SSLNINSQSYITWMTWANLEEDQGNSIRAEEIRNLYFQQRTEVVDDESWIMGFLDVIDPAIDSIKRLLNLDQNSYYKVKESTSNTTAGDD
VEGSTEESASPSSANVNDNNIDTGSGFDLDDFIRVMLSLDPSKLEVQLTTSLKDPX
Predicted Coding Sequence 
GAGCACGATATTTGTTCAAGCAGGCAACAAGGTGTAACCGAAAAAGTTGXTGCTAGTTGGCTGGCATGGGCTCAACTAGAGGCTCAGTTA
GAGAATAACCGTACTGCTAGGCAACTGTTTGAGAAAGCAGTTCAAGCCAGTCCGAAAAATAGGTTCGCGTGGCATGTATGGGGAGTTTTT
GAAGCTAATCTGGGAAATATTGACCAAGGAAGGAAACTTCTGACAATAGGGCACATGATGAATCCTAGAGATCCTGXTCCTCCTCCAGTC
ACTTGGTTTGATAGAATACAAGAACTCCAGTGCAAACCTTGCACGAGTTCTATTCCGAAGGGCATCTCAACTGGATCCAAGGCACCACCA
GTTTGGATTGCTTGGGGTTGGATGGAGTGGAAAGAAGGAAACATTTCCACAGCTCGAGAACTATACCAGAAAGCTCTATCGATCAACTCA
ACTACTGAAAGTGCAGCACGCTGTCTTCAGGCTTGGGGTGTTTTGGAGCAAAGAGCTGGAAATCTATCAGCTGCTCGAAGATTATTTAGA
TCGTCTCTGAACATAAACTCTCAGAGCTATATAACATGGATGACATGGGCAAATTTGGAGGAAGATCAAGGTAACTCTATCCGTGCAGAG
GAAATTCGTAACCTCTACTTTCAACAGCGTACTGAAGTTGTTGATGATGAGTCGTGGATTATGGGCTTCTTAGACGTCATTGATCCAGCG
ATTGATAGCATAAAGAGGCTCTTGAATTTAGATCAAAATTCTTATTACAAGGTAAAAGAGTCTACTTCTAATACTACTGCTGGAGACGAC
GTTGAGGGGAGCACAGAAGAATCAGCTTCCCCCTCCTCGGCTAACGTCAATGACAATAACATAGATACAGGAAGTGGCTTTGATTTAGAT
GATTTTATCCGTGTAATGCTGTCTTTGGACCCTTCAAAACTGGAAGTTCAGCTTACAACATCTCTGAAGGACCCTCXX\
Edits in Original Sequence 
(5')GAGCACGATATTTGTTCAAGCAGGCAACAAGGTGTAACCGAAAAAGTTGXTGCTAGTTGGCTGGCATGGGCTCAACTAGAGGCTCA
GTTAGAGAATAACCGTACTGCTAGGCAACTGTTTGAGAAAGCAGTTCAAGCCAGTCCGAAAAATAGGTTCGCGTGGCATGTATGGGGAGT
TTTTGAAGCTAATCTGGGAAATATTGACCAAGGAAGGAAACTTCTGACAATAGGGCACATGATGAATCCTAGAGATCCTGXTCCTCCTCC
AGTCACTTGGTTTGATAGAATACAAGAACTCCAGTGCAAACCTTGCACGAGTTCTATTCCGAAGGGCATCTCAACTGGATCCAAGGCACC
aACCAGTTTGGATTGCTTGGGGTTGGATGGAGTGGAAAGAAGGAAACATTTCCACAGCTCGAGAACTATACCAGAAAGCTCTATCGATCA
ACTCAACTACTGAAAGTGCAGCACGCTGTCTTCAGGCTTGGGGTGTTTTGGAGCAAAGAGCTGGAAATCTATCAGCTGCTCGAAGATTAT
TTAGATCGTCTCTGAACATAAACTCTCAGAGCTATATAACATGGATGACATGGGCAAATTTGGAGGAAGATCAAGGTAACTCTATCCGTG
CAGAGGAAATTCGTAACCTCTACTTTCAACAGCGTACTGAAGTTGTTGATGATGAGTCGTGGATTATGGGCTTCTTAGACGTCATTGATC
CAGCGATTGATAGCATAAAGAGGCTCTTGAATTTAGATCAAAATTCTTATTACAAGGTAAAAGAGTCTACTTCTAATACTACTGCTGGAG
ACGACGTTGAGGGGAGCACAGAAGAATCAGCTTCCCCCTCCTCGGCTAACGTCAATGACAATAACATAGATACAGGAAGTGGCTTTGATT
TAGATGATTTTATCCGTGTAATGCTGTCTTTGGACCCTTCAAAACTGGAAGTTCAGCTTACAACATCTCTGAAGGACCCTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan