ESTScan Details for Unigene SGN-U278269

Score 
191
Direction 
Forward
Predicted Peptide Sequence 
RALIPIARFFLNQFYVVPHIMHYGKVDSTTNSIKFPLSRLCNAGQQCFLGYGSFSSSHLLTFYGFLPQQDNYYDVIPLDIDVASNEDCAD
TDPTPDWTSHMVRGTWFSKNHGIFHYGLPPPLLDRMRRSRNPSLQSMTLTPENLEIELEILRDLCSMFEEMRDGLGDPELDNRETTSWDV
KLAVDFKDLQRRIFSSIVASCQAGCELENVKCKDTHCSVALPEGNNSAEALLFFRIVKXITASNFIKINLVN
Predicted Coding Sequence 
XXCCGTGCTTTAATCCCAATTGCCAGGTTTTTCTTAAATCAGTTCTACGTTGTCCCACACATAATGCACTATGGGAAAGTTGATTCCACG
ACAAATTCTATAAAATTTCCTTTGTCAAGGTTGTGTAATGCAGGACAACAATGTTTTCTTGGCTACGGGAGCTTCTCTAGTTCTCATCTA
CTGACCTTCTATGGTTTTCTACCACAACAAGATAACTACTATGATGTGATTCCGCTAGATATTGATGTTGCAAGTAATGAAGATTGTGCA
GACACAGACCCTACACCTGATTGGACCTCCCATATGGTCCGTGGAACCTGGTTCTCAAAGAATCACGGCATCTTCCATTATGGGTTACCA
CCGCCTCTACTGGATCGTATGCGTAGATCTCGGAATCCTTCCTTGCAGTCAATGACTCTTACACCAGAGAACTTGGAAATTGAACTCGAA
ATACTTAGGGACCTTTGTTCTATGTTCGAAGAAATGCGGGATGGGCTAGGAGATCCTGAATTGGATAACAGGGAGACCACAAGTTGGGAT
GTAAAGCTTGCAGTGGATTTCAAAGATTTACAGAGGAGGATTTTCTCCTCCATTGTTGCTTCATGTCAGGCAGGATGTGAGTTGGAAAAT
GTGAAATGCAAAGATACACATTGTAGTGTAGCGCTACCGGAAGGGAACAACAGTGCTGAAGCTCTTCTATTTTTTAGGATTGTTAAAXTT
ATTACTGCAAGTAATTTTATTAAGATAAACCTAGTCAACTAG\
Edits in Original Sequence 
(5')XXCCGTGCTTTAATCCCAATTGCCAGGTTTTTCTTAAATCAGTTCTACGTTGTCCCACACATAATGCACTATGGGAAAGTTGATTC
CACGACAAATTCTATAAAATTTCCTTTGTCAAGGTTGTGTAATGCAGGACAACAATGTTTTCTTGGCTACGGGAGCTTCTCTAGTTCTCA
TCTACTGACCTTCTATGGTTTTCTACCACAACAAGATAACTACTATGATGTGATTCCGCTAGATATTGATGTTGCAAGTAATGAAGATTG
TGCAGACACAGACCCTACACCTGATTGGACCTCCCATATGGTCCGTGGAACCTGGTTCTCAAAGAATCACGGCATCTTCCATTATGGGTT
ACCACCGCCTCTACTGGATCGTATGCGTAGATCTCGGAATCCTTCCTTGCAGTCAATGACTCTTACACCAGAGAACTTGGAAATTGAACT
CGAAATACTTAGGGACCTTTGTTCTATGTTCGAAGAAATGCGGGATGGGCTAGGAGATCCTGAATTGGATAACAGGGAGACCACAAGTTG
GGATGTAAAGCTTGCAGTGGATTTCAAAGATTTACAGAGGAGGATTTTCTCCTCCATTGTTGCTTCATGTCAGGCAGGATGTGAGTTGGt
AAAATGTGAAATGCAAAGATACACATTGTAGTGTAGCGCTACCGGAAGGGAACAACAGTGCTGAAGCTCTTCTATTTTTTAGGATTGTTA
AAXTTATTACTGCAAGTAATTTTATTAAGATAAACCTAGTCAACTAG\(3')TTAGCACTTTTAATTAGGAGTTGAATTCTATTTGAATT
TTGAATAAGTTGTATTTTATAGACTTTCGGAGTGGTATTTTCAATATATCTTTTTTGCTTAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan