ESTScan Details for Unigene SGN-U278355

Score 
370
Direction 
Forward
Predicted Peptide Sequence 
KQMASTTSPSLSLSSSSTLVDGKTTRQSAAVASSQCVTLPTLPPPPAVQSRAARTTAYCRKIARNVAAMATSTGEVATAEATGETATTEL
PSELVQKIQEVWDKVDDKYAVSSLGVAAFILLWSSTGVISAIDRLPLIPGXLELVGIGYTG
Predicted Coding Sequence 
AAGCAAATGGCCTCTACAACTTCCCCTTCACTTTCTCTCTCTTCTTCATCGACCCTCGTCGACGGCAAGACAACTCGTCAGTCCGCTGCC
GTGGCATCGTCGCAATGTGTGACACTACCCACCCTTCCACCGCCGCCGGCCGTTCAAAGCCGTGCTGCCAGAACCACTGCTTACTGTAGA
AAGATTGCAAGGAATGTGGCCGCAATGGCTACATCAACTGGAGAAGTTGCCACAGCAGAGGCCACAGGAGAAACGGCAACCACTGAGCTA
CCATCAGAGCTTGTCCAAAAAATTCAAGAAGTTTGGGACAAAGTTGATGATAAGTACGCAGTCAGTTCATTGGGTGTTGCTGCATTTATT
CTGCTTTGGAGCTCCACTGGAGTGATCTCGGCAATTGACAGGCTTCCTTTGATTCCTGGTGXTCTTGAGCTTGTAGGAATTGGTTACACC
GGTTAA\
Edits in Original Sequence 
(5')AAGCAAATGGCCTCTACAACTTCCCCTTCACTTTCTCTCTCTTCTTCATCGACCCTCGTCGACGGCAAGACAACTCGTCAGTCCGC
TGCCGTGGCATCGTCGCAATGTGTGACACTACCCACCCTTCCACCGCCGCCGGCCGTTCAAAGCCGTGCTGCCAGAACCACTGCTTACTG
TAGAAAGATTGCAAGGAATGTGGCCGCAATGGCTACATCAACTGGAGAAGTTGCCACAGCAGAGGCCACAGGAGAAACGGCAACCACTGA
GCTACCATCAGAGCTTGTCCAAAAAATTCAAGAAGTTTGGGACAAAGTTGATGATAAGTACGCAGTCAGTTCATTGGGTGTTGCTGCATT
TATTCTGCTTTGGAGCTCCACTGGAGTGATCTCGGCAATTGACAGGCTTCCTTTGATTCCTGGTGXTCTTGAGCTTGTAGGAATTGGTTA
CACCGGTTAA\(3')GTTGAAATATTTTCACTCTTACCACTACTCTGTATGTGTAACCTGAATGCTCTATAACCAATAATTACACTGATA
GGGTAAAAAATAAACGTTACACTTAAGTTAAATCCTTTCTTTGAACCATATTGCATAGGCATTAGCATCAGATTTCATCAATGCTTCTTT
GGTTAAGCTTTGAACTATATAATCGATCACCATGTTATCTTGAACTCATTTACACGTTTTTGGGGGATCTTCCCTTCCTTTGCAGTGGTT
TGCCTACAAGAACTTGATCTTCAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan