ESTScan Details for Unigene SGN-U278507

Score 
563
Direction 
Forward
Predicted Peptide Sequence 
MSRFAXKNEIFEEFRTTQLDELPESEELELHNKPYLKQIDNGVVSDVEEEQKKVSKDEVLEPFYKLFKPTESNEEESDTEQEEEVHPVVE
ESKKVSVEYYEPKPGDLVVGVVVSGNENKLDVSVGADLLGTMLTKDVLPLYDKEMGYLLCDLEKDAEEFLVRGKMGIVSYDDAISGESTS
GKPVVEPGTVLFAEVLGRTLSGRPLLSTRRLFRRIAXASSEIKQLNEPIX
Predicted Coding Sequence 
ATGTCTCGTTTTGCTXCTAAAAATGAAATCTTTGAAGAATTTAGGACTACCCAGTTGGATGAATTGCCTGAAAGTGAAGAGCTTGAATTA
CATAATAAGCCATATTTAAAGCAAATAGATAATGGGGTTGTCTCAGATGTAGAGGAGGAGCAGAAAAAAGTTAGTAAAGATGAAGTTTTG
GAGCCATTTTATAAGTTATTTAAGCCTACAGAGTCTAATGAAGAAGAAAGTGATACAGAACAAGAGGAAGAGGTTCATCCAGTTGTAGAA
GAGAGTAAGAAGGTTAGTGTGGAGTATTATGAACCGAAACCGGGTGATTTGGTGGTAGGTGTTGTGGTTTCGGGGAATGAGAATAAGCTT
GATGTGAGTGTTGGTGCTGACCTATTGGGTACCATGTTAACTAAGGATGTTTTGCCTTTGTATGACAAAGAGATGGGCTATTTGCTGTGT
GATTTAGAGAAGGATGCTGAGGAATTTTTGGTGAGAGGGAAAATGGGAATTGTGAGCTACGATGATGCAATTAGTGGGGAATCAACGTCA
GGGAAGCCCGTTGTGGAACCTGGGACTGTACTTTTTGCTGAGGTTCTTGGAAGAACTCTCAGTGGTCGACCACTACTGTCAACAAGAAGA
CTCTTTAGACGCATTGCCXTGGCATCGAGTGAGATTAAACAACTAAATGAACCTATTGXX\
Edits in Original Sequence 
GGGCCCCCCCTCGAGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCCCTTTCTCACAAATACCCACTTGCTAGAATCCCAAAATCT
TCCAAGAATCTCTCACTCCATTGGAATTATCAAATAAGTTTGCATACCC
(5')ATGTCTCGTTTTGCTXCTAAAAATGAAATCTTTGAAG
AATTTAGGACTACCCAGTTGGATGAATTGCCTGAAAGTGAAGAGCTTGAATTACATAATAAGCCATATTTAAAGCAAATAGATAATGGGG
TTGTCTCAGATGTAGAGGAGGAGCAGAAAAAAGTTAGTAAAGATGAAGTTTTGGAGCCATTTTATAAGTTATTTAAGCCTACAGAGTCTA
ATGAAGAAGAAAGTGATACAGAACAAGAGGAAGAGGTTCATCCAGTTGTAGAAGAGAGTAAGAAGGTTAGTGTGGAGTATTATGAACCGA
AACCGGGTGATTTGGTGGTAGGTGTTGTGGTTTCGGGGAATGAGAATAAGCTTGATGTGAGTGTTGGTGCTGACCTATTGGGTACCATGT
TAACTAAGGATGTTTTGCCTTTGTATGACAAAGAGATGGGCTATTTGCTGTGTGATTTAGAGAAGGATGCTGAGGAATTTTTGGTGAGAG
GGAAAATGGGAATTGTGAGCTACGATGATGCAATTAGTGGGGAATCAACGTCAGGGAAGCCCGTTGTGGAACCTGGGACTGTACTTTTTG
CTGAGGTTCTTGGAAGAACTCTCAGTGGTCGACCACTACTGTCAACAAGAAGACTCTTTAGACGCATTGCCXTGGCATCGAGTGAGATTA
AACAACTAAATGAACCTATTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan