ESTScan Details for Unigene SGN-U278581

Score 
481
Direction 
Forward
Predicted Peptide Sequence 
MERLRCQRIGCNATFTEDDNPEGSCTYHDSAPLFHDGTKQWSCCKKKSHDFSLFLEIPGCKTGKHTTEKPVIATPSATKNKAIPVPVSVP
APMTNASPKKPVLDATRDSFVLIMVHNPXEAIPKASNTVASVPSGSNTVVQQDHPAPVKKKIDINEPQICKNKSCSKTFTEKENHDTACS
YHPGPAIFHDRMKGWKCCDVHVKEFDEFMX
Predicted Coding Sequence 
ATGGAGAGACTTCGATGTCAGAGGATCGGTTGCAACGCTACCTTCACTGAGGATGATAATCCTGAAGGCTCATGCACTTATCACGATTCC
GCTCCTTTATTTCATGATGGAACGAAGCAGTGGAGTTGTTGCAAGAAAAAAAGTCATGATTTCAGTTTATTTCTTGAAATTCCTGGGTGT
AAGACAGGAAAGCACACAACAGAAAAACCAGTGATCGCAACACCATCTGCTACCAAAAATAAAGCAATTCCTGTGCCGGTGAGTGTGCCA
GCTCCTATGACCAATGCATCACCAAAGAAGCCTGTCCTAGATGCCACCAGGGATTCTTTTGTTCTGATCATGGTTCACAACCCAGAXGAA
GCAATTCCAAAAGCATCAAATACAGTAGCATCTGTACCTTCTGGGAGCAATACAGTTGTACAGCAAGACCATCCAGCTCCAGTGAAGAAG
AAAATTGATATAAATGAGCCCCAAATTTGTAAAAACAAGAGCTGCAGTAAGACCTTTACAGAAAAGGAAAATCACGACACTGCTTGTAGT
TACCATCCTGGCCCTGCTATCTTCCATGACCGGATGAAAGGATGGAAATGCTGTGATGTTCATGTCAAAGAATTTGACGAGTTCATGAXX
\
Edits in Original Sequence 
AATAAGATGGGCCAAGAGAATATTGGGAAAACCCAGATTCCAAGAAATAAATTTGGGGAAAAAGAAAAGAATTTGTAAAGACTTTGCAAT
CAGTTTTTTCTAGTGTCAGAGTTACAGTAGTTTCTAGAGAATCAGCA
(5')ATGGAGAGACTTCGATGTCAGAGGATCGGTTGCAACGCT
ACCTTCACTGAGGATGATAATCCTGAAGGCTCATGCACTTATCACGATTCCGCTCCTTTATTTCATGATGGAACGAAGCAGTGGAGTTGT
TGCAAGAAAAAAAGTCATGATTTCAGTTTATTTCTTGAAATTCCTGGGTGTAAGACAGGAAAGCACACAACAGAAAAACCAGTGATCGCA
ACACCATCTGCTACCAAAAATAAAGCAATTCCTGTGCCGGTGAGTGTGCCAGCTCCTATGACCAATGCATCACCgAAAGAAGCCTGTCCT
AGATGCCACCAGGGATTCTTTTGTTCTGATCATGGTTCACAACCCAGAXGAAGCAATTCCAAAAGCATCAAATACAGTAGCATCTGTACC
TTCTGGGAGCAATACAGTTGTACAGCAAGACCATCCAGCTCCAGTGAAGAAGAAAATTGATATAAATGAGCCCCAAATTTGTAAAAACAA
GAGCTGCAGTAAGACCTTTACAGAAAAGGAAAATCACGACACTGCTTGTAGTTACCATCCTGGCCCTGCTATCTTCCATGACCGGATGAA
AGGATGGAAATGCTGTGATGTTCATGTCAAAGAATTTGACGAGTTCATGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan