ESTScan Details for Unigene SGN-U278765

Score 
723
Direction 
Forward
Predicted Peptide Sequence 
MEITSRIQDRENPSSINHQEAMEQVPTTFVQADTSSFKQVVQMLTGSSETAKQASGSDPSSSSNSNSAKSSIPPIRNAPKKPGFKLYERR
NSLKNGFMISPLIPGIHAQNSSFSPRNKLEILSPSILDFPSLALSPVTPLNEDPFNKSSPLTNLSEEDKAIAEKKFYLHPSPEKNTERFS
TTAFASVSGEFSESFRVFFLK
Predicted Coding Sequence 
ATGGAAATCACTTCAAGAATTCAAGATAGAGAGAACCCATCTTCCATTAACCACCAAGAAGCAATGGAACAAGTCCCAACAACTTTTGTT
CAAGCTGATACTTCTTCCTTCAAACAAGTTGTTCAAATGCTAACTGGATCATCTGAAACTGCTAAACAAGCATCAGGCTCAGATCCGTCT
TCCTCTTCAAATTCAAATTCAGCCAAAAGTTCAATTCCCCCAATTCGAAACGCACCGAAGAAACCAGGGTTCAAGCTCTACGAAAGGAGA
AACAGTTTGAAAAATGGGTTTATGATTAGCCCTTTGATTCCTGGAATTCATGCTCAGAATTCGAGTTTTTCTCCTCGGAACAAACTGGAG
ATTCTCTCGCCGAGTATTCTAGATTTCCCTTCACTTGCTTTAAGCCCTGTTACGCCATTGAATGAAGACCCATTTAATAAATCTTCGCCA
TTAACGAATCTGTCTGAAGAAGATAAAGCTATTGCTGAGAAGAAGTTTTATTTGCATCCTTCACCXGAGAAGAACACCGAGAGATTCTCA
ACCACAGCTTTTGCCTCTGTTTCCGGTGAGTTCTCCGAGAGTTTCAGGGTCTTCTTCTTGAAGTGA\
Edits in Original Sequence 
GAAGAATTATATTCATTTCACGAAAACCTCGCACCATAAAAGCAAATATAACAAGAGAGAAAGAGAAAGAGTCTTTTTTGTTGTTGAGGA
GAGAAAATTAGTCTTAAAAGAGAAAAAGGAAAGACTTGAAGGCTCAAACAAAGTGCACAAAGTCCACAAACAAAAGCAAAATTACTTGTA
ATGCTTCTATTCTTTCTTCCCCATTAGCCTTGTTTTTCACTCCAAACAAACTTTGCTTTCTTCTCTTCTTTCATCTTCTTCTTGTTGTTG
ATTTTCATTTGAGATAGTAACA
(5')ATGGAAATCACTTCAAGAATTCAAGATAGAGAGAACCCATCTTCCATTAACtCACCAAGAAGCA
ATGGAACAAGTCCCAACAACTTTTGTTCAAGCTGATACTTCTTCCTTCAAACAAGTTGTTCAAATGCTAACTGGATCATCTGAAACTGCT
AAACAAGCATCAGGCTCAGATCCGTCTTCCTCTTCAAATTCAAATTCAGCCAAAAGTTCAATTCCCCCAATTCGAAACGCACCGAAGAAA
CCAGGGTTCAAGCTCTACGAAAGGAGAAACAGTTTGAAAAATGGGTTTATGATTAGCCCTTTGATTCCTGGAATTCATGCTCAGAATTCG
AGTTTTTCTCCTCGGAACAAACTGGAGATTCTCTCGCCGAGTATTCTAGATTTCCCTTCACTTGCTTTAAGCCCTGTTACGCCATTGAAT
GAAGACCCATTTAATAAATCTTCGCCATTAACGAATCTGTCTGAAGAAGATAAAGCTATTGCTGAGAAGAAGTTTTATTTGCATCCTTCA
CCXGAGAAGAACACCGAGAGATTCTCAACCACAGCTTTTGCCTCTGTTTCCGGTGAGTTCTCCGAGAGTTTCAGGGTCTTCTTCTTGAAG
TGA\(3')ATTTTCTGTGATTTGTGCTGCTGTGAGAAGGAGAATTTCAGCTTAATTTGAAGAGCAAACAAGGTAGAGATCTTTGCTTCAC
TTGTATAATTTGATCTCCTTTTTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan