ESTScan Details for Unigene SGN-U278918

Score 
614
Direction 
Forward
Predicted Peptide Sequence 
TSGEFRIGRYEMGKSVNSFSHKVRWSKGPRGTVLIYPLKGDVWALYRNWSADWNQNTPDDVIHKYDMVLVLDDYNEEQGISVAPLIKVAG
FKXSLSSRLEFREGDENNQRTDVSFLSSGPKPPSSGEEGQNAPKGCQELDPAATPLELLQTLTETNEVPAMQNDKEANGGSSQNVQETKT
SETAEHTLKSREGGMEKVKELHENAEEQLEQLFAAEGLNYAKXISVMRRYFEDTSSCRLLVRPLDYLTXMRLVLVLNKAEVWVLFMEQAY
YVEFDEMVTLEALILYLAQSKWVIREKYQTQFNANSEKDQGSPFPRYXKSAP
Predicted Coding Sequence 
XXAACTTCTGGTGAATTTAGGATTGGCAGATACGAAATGGGTAAGTCGGTGAATTCCTTCTCCCACAAGGTTCGGTGGTCAAAGGGCCCT
CGTGGAACTGTTCTAATATATCCCCTAAAGGGGGATGTTTGGGCCCTCTACAGAAATTGGTCTGCTGACTGGAATCAGAATACACCTGAT
GATGTTATACACAAGTATGACATGGTCCTAGTTCTTGACGACTACAATGAGGAGCAAGGAATTTCAGTAGCTCCTCTCATCAAAGTTGCT
GGTTTTAAGXACAGTCTTTCGTCCAGACTTGAATTCAGAGAAGGTGATGAGAATAACCAGAGAACAGATGTTTCGTTTCTCTCATCAGGT
CCCAAGCCACCTTCTTCAGGTGAAGAAGGTCAAAATGCTCCAAAGGGTTGCCAGGAGCTTGATCCAGCTGCTACTCCATTGGAGCTTCTT
CAGACACTAACAGAAACTAATGAGGTGCCAGCCATGCAGAACGACAAAGAGGCCAATGGAGGTTCATCACAGAATGTTCAGGAAACCAAA
ACTAGTGAGACTGCTGAACATACTCTCAAATCCAGGGAAGGCGGGATGGAGAAAGTGAAGGAGCTCCATGAAAATGCAGAGGAGCAACTT
GAACAACTTTTTGCAGCTGAGGGTTTGAATTATGCCAAAATXATTAGTGTAATGAGGAGATATTTTGAAGATACATCTAGTTGTAGACTT
TTGGTCAGACCTTTAGACTATTTAACTGAXATGAGATTAGTCTTGGTTCTGAACAAAGCAGAAGTATGGGTTCTATTCATGGAGCAGGCC
TATTACGTGGAGTTTGATGAGATGGTTACTTTGGAGGCCCTCATTTTGTACCTTGCTCAAAGCAAATGGGTGATCAGAGAAAAATATCAA
ACACAGTTTAATGCTAATAGCGAAAAGGATCAAGGATCTCCATTCCCCAGATACAXCAAGTCTGCTCCCTAA\
Edits in Original Sequence 
(5')XXAACTTCTGGTGAATTTAGGATTGGCAGATACGAAATGGGTAAGTCGGTGAATTCCTTCTCCCACAAGGTTCGGTGGTCAAAGGG
CCCTCGTGGAACTGTTCTAATATATCCCCTAAAGGGGGATGTTTGGGCCCTCTACAGAAATTGGTCTGCTGACTGGAATCAGAATACACC
TGATGATGTTATACACAAGTATGACATGGTCCTAGTTCTTGACGACTACAATGAGGAGCAAGGAATTTCAGTAGCTCCTCTCATCAAAGT
TGCTGGTTTTAAGXACAGTCTTTCGTCCAGACTTGAATTCAGAGAAGGTGATGAGAATAACCAGAGAACAGATGTTTCGTTTCTCTCATC
AGGTCCCAAGCCACCTTCTTaCAGGTGAAGAAGGTCAAAATGCTCCAAAGGGTTGCCAGGAGCTTGATCCAGCTGCTACTCCATTGGAGC
TTCTTCAGACACTAACAGAAACTAATGAGGTGCCAGCCATGCAGAACGACAAAGAGGCCAATGGAGGTTCATCACAGAATGTTCAGGAAA
CCAAAACTAGTGAGACTGCTGAACATACTCTCAAATCCAGGGAAGGCGGGATGGtAGAAAGTGAAGGAGCTCCATGAAAATGCAGAGGAG
CAACTTGAACAACTTTTTGCAGCTGAGGGTTTGAATTATGCCAAAATXATTAGTGTAATGAGGAGATATTTTGAAGATACATCTAGTTGT
AGACTTTTGGTCAGACCTTTAGACTATTTAACTGAXATGAGATTAGTCTTGGTTCTGAACAAAGCAGAAGTATGGGTTCTATTCATGGAG
CAGGCCTATTACGTGGAGTTTGAtTGAGATGGTTACTTTGGAGGCCCTCATTTTGTACCTTGCTCAAAGCAAATGGGTGATCAGAGAAAA
ATATCAAACACAGTTTAATGCTAATAGCGAAAAGGATCAAGGATCTCCATTCCCCAGATACAXCAAGTCTGCTCCCTAA\(3')CTTTAT
ATTCTCTTTGGATGCCTTATATTCCCATAGGTGTACTTGAACCTTTCCTTTTGGTTTTGAATCCTGTAAAGGCATCCGCAAAGGTTTTTG
TTTCTCTCCAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan