ESTScan Details for Unigene SGN-U279111

Score 
173
Direction 
Forward
Predicted Peptide Sequence 
SLSNLEELYLDNNFLEGEIPQSFNGLKNLKRLEFQGNQITGEFPELDQLINLNFIDASDNAISGELPASYPASLIELTMRNNSIEGNXSG
EPHRTEFRTSYRSESQQTQWVSASESLHSPIPRTAHPINNQFGSVQEPGISFQNSQLIAADLSNNEIRGLLPGFLGLMPRLSSLSLENNK
LSGMIPTQYALKMVFPGEGVSQFERLLLGGNYLFGPIPGPLLDLKAGSVTVRLGATVCTGAR
Predicted Coding Sequence 
XXTTCACTTTCAAACCTTGAAGAGCTTTACCTTGACAATAATTTCCTTGAGGGAGAAATTCCCCAAAGTTTCAACGGTCTCAAGAATTTG
AAACGGCTCGAATTTCAAGGCAATCAGATTACTGGCGAGTTTCCCGAGTTGGATCAGTTAATTAATTTGAATTTCATCGATGCTAGTGAT
AATGCTATCTCCGGCGAACTCCCGGCGAGTTATCCGGCATCTCTCATCGAGCTTACGATGAGAAACAACAGCATAGAAGGTAACXATTCC
GGCGAGCCTCATCGGACTGAATTTCGTACAAGTTATCGATCTGAGTCACAACAAACTCAGTGGGTCAGTGCCAGCGAGTCTCTTCACTCA
CCCATCCCTCGAACAGCTCACCCTATCAACAATCAATTCGGGTCGGTTCAGGAACCCGGGATCTCGTTTCAGAATAGTCAGCTTATTGCA
GCAGACTTAAGCAACAATGAGATCCGTGGGTTATTACCCGGGTTCCTGGGTTTAATGCCTAGATTATCATCACTTTCACTAGAGAACAAC
AAGTTATCGGGTATGATACCGACCCAATATGCATTGAAAATGGTGTTTCCGGGTGAAGGGGTGTCTCAATTTGAGAGGCTACTGTTAGGA
GGAAACTATTTATTCGGACCCATACCGGGTCCATTGTTGGATCTGAAAGCGGGTTCAGTCACAGTGAGATTAGGAGCAACTGTTTGTACC
GGTGCCCGTTGA\
Edits in Original Sequence 
(5')XXTTCACTTTCAAACCTTGAAGAGCTTTACCTTGACAATAATTTCCTTGAGGGAGAAATTCCCCAAAGTTTCAACGGTCTCAAGAA
TTTGAAACGGCTCGAATTTCAAGGCAATCAGATTACTGGCGAGTTTCCCGAGTTGGATCAGTTAATTAATTTGAATTTCATCGATGCTAG
TGATAATGCTATCTCCGGCGAACTCCCGGCGAGTTATCCGGCATCTCTCATCGAGCTTACGATGAGAAACAACAGCATAGAAGGTAACXA
TTCCGGCGAGCCTCATCGGACTGAATTTCGTACAAGTTATCGATCTGAGTCACAACAAACTCAGTGGGTCAGTGCCAGCGAGTCTCTTCA
CTCACCCATCCCTCGAACAGCTCACCCTATCAtACAATCAATTCGGGTCGGTTCAGGAACCCGGGATCTCGTTTCAGAATAGTCAGCTTA
TTGCAGCAGACTTAAGCAACAATGAGATCCGTGGGTTATTACCCGGGTTCCTGGGTTTAATGCCTAGATTATCATCACTTTCACTAGAGA
ACAACAAGTTATCGGGTATGATACCGACCCAATATGCATTGAAAATGGTGTTTCCGGGTGAAGGGGTGTCTCAATTTGAGAGGCTACTGT
TAGGAGGAAACTATTTATTCGGACCCATACCGGGTCCATTGTTGGATCTGAAAGCGGGTTCAGTCACAGTGAGATTAGGAGaCAACTGTT
TGTACCGGTGCCCGTTGA\(3')GATTATTTTTATGTGAAGGTGGGGAACAGAAATCATTATCGGAGTGTCAGGCTTTTGGTCCCATCAT
TCCTTGATTAATGTGATAATGTCTTTACTTTGAGGTCCTCATTTTCATTTTGTACTATAGTAATTATTGTATCGTTTCAATTTTATCGGA
AGGGACTAGTAAGTATTGTATAAGAGTGATTTTCCTGCAACCTTACAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan