ESTScan Details for Unigene SGN-U279278

Score 
307
Direction 
Forward
Predicted Peptide Sequence 
QYSSIQGNNERVSIRIEESSKTIDGNNGENLGLPKGYINKSFNNGEEGSENAFFGTKVSHYPPCPNPEMVNGLRAHTDAGGVILLFQDDQ
VDGLQILKDGKWIDVQPIQNAIVINTGDQIEVLSNGKYKSVWHRVLAKENGNRRSIASFYNPSLKATIAPAPQLIHIDNDNNNDNNKVEL
ISNYPAFKFGDYMNVYSEQKFSPKEPRFQAVRAM
Predicted Coding Sequence 
CAATATTCCTCAATTCAGGGAAATAATGAAAGAGTATCGATCAGAATTGAAGAATCTAGCAAAACAATTGATGGAAATAATGGAGAAAAC
TTAGGTCTACCAAAAGGTTACATCAATAAATCGTTTAATAACGGCGAAGAAGGTTCCGAAAATGCGTTTTTCGGGACTAAAGTCAGTCAT
TATCCACCGTGCCCAAATCCCGAAATGGTGAATGGTCTACGAGCACACACCGATGCTGGTGGTGTAATTTTGCTTTTTCAGGATGATCAG
GTAGACGGTCTTCAAATTCTCAAGGATGGCAAATGGATCGATGTTCAACCGATCCAAAATGCCATCGTTATCAACACGGGTGACCAAATT
GAGGTCCTTAGTAACGGGAAATACAAGAGTGTTTGGCATCGCGTTTTAGCAAAGGAAAATGGTAATAGAAGGTCAATTGCGTCTTTTTAT
AATCCGTCTTTAAAAGCTACGATCGCTCCTGCACCTCAACTAATTCATATTGATAATGATAATAATAACGACAACAATAAGGTGGAATTA
ATTAGTAATTATCCAGCTTTTAAGTTTGGTGATTATATGAATGTTTATAGTGAACAAAAATTTTCACCTAAAGAGCCAAGATTCCAAGCT
GTTAGAGCCATGTGATGA\
Edits in Original Sequence 
(5')CAATATTCCTCAATTCAGGGAAATAATGAAAGAGTATCGATCAGAATTGAAGAATCTAGCAAAACAATTGATGGAAATAATGGAcG
AAAACTTAGGTCTACCAAAAGGTTACATCAATAAATCGTTTAATAACGGCGAAGAAGGTTCCGAAAATGCGTTTTTCGGGACTAAAGTCA
GTCATTATCCACCGTGCCCAAATCCCGAAATGGTGAATGGTCTACGAGCACACACCGATGCTGGTGGTGTAATTTTGCTTTTTCAGGATG
ATCAGGTAGACGGTCTTCAAATTCTCAAGGATGGCAAATGGATCGATGTTCAACCGATCCAAAATGCCATCGTTATCAACACGGGTGACC
AAATTGAGGTCCTTAGTAACGGGAAATACAAGAGTGTTTGGCATCGCGTTTTAGCAAAGGAAAATGGTAATAGAAGGTCAATTGCGTCTT
TTTATAATCCGTCTTTAAAAGCTACGATCGCTCCTGCACCTCAACTAATTCATATTGATAATGATAATAATAACGACAACAATAAGGTGG
AATTAATTAGTAATTATCCAGCTTTTAAGTTTGGTGATTATATGAATGTTTATAGTGAACAAAAATTTTCACCTAAAGAGCCAAGATTCC
AAGCTGTTAGAGCCATGTGATGA\(3')TGGTCAAGAAGGAGACATTTTATTATTCCATTTTATCATAAGCTTAATTTGTACTTTTAAAA
AAAATAATATTTTTAGTAATGTGTGAATTAAGTCTAGTTTTTTTTTCTTCTTTGTTTGGTTTGTGGGGAATTGTTTGTATTACTTGGATT
GTCAATCTTCAATATGGCAGTGCACAAAATTATGCCTGTTTTCTTGTAATATTTTGTATTTTCGCTTTCGCGATATATGCATCTAGATAT
TATTTCTATCTTTGTAAATTACAAATATTGTATCATGATAAACATGCATGTGTGTTTTTACAGTATATAAATTATTGTTAGCCAAAAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan