ESTScan Details for Unigene SGN-U279282

Score 
196
Direction 
Reverse
Predicted Peptide Sequence 
MTKGIXAVKTKQHSRGNXIIGDEISXRLSISSYAKTPVCHIKNKSFRSFNISEYKCKIATLSALAPNEPPESIPPYHPPSLQLHLKRNDA
FPXALDAYCLKDNLTGFPAHHHLFFCQKQSTLELNATNTLYANKESTRLAIPGTDFVLEXASLMPLRLAAKQIGNEPTPPVPITIWGLNS
LNIWELLIRDLTRTKGRTNXVVEEKKGRPNGAAGIGSKEYPAVGTAGAFHSSLKSNKENLGIWVKDFKVVSNGNRRKIWPPVPPAANMIR
RVSVVAGASPDAXGALIVGFVERETVTDLEIPRLKLNGGAKVKDLGTENWVLKVPAGSGKRVN
Predicted Coding Sequence 
ATGACAAAAGGCATTGXAGCTGTTAAAACGAAACAACACTCACGGGGTAATGXTATAATCGGGGATGAAATTTCACXGAGGCTCTCCATC
TCATCATATGCTAAGACCCCGGTTTGCCATATCAAAAACAAGTCTTTCCGTTCTTTTAACATCTCAGAATACAAATGCAAAATAGCAACA
TTAAGTGCATTAGCACCCAATGAGCCTCCAGAATCAATACCACCTTACCATCCCCCTTCCCTACAACTGCATTTGAAAAGAAATGACGCC
TTCCCAXCGGCCTTAGACGCATATTGCCTCAAAGACAATCTCACTGGATTTCCXGCACACCACCATTTGTTCTTTTGCCAAAAACAATCA
ACACTAGAATTAAATGCAACAAACACATTATATGCAAATAAAGAAAGCACCCGATTAGCGATTCCGGGTACTGATTTTGTTCTTGAAXTT
GCAAGTTTAATGCCTTTGAGACTTGCAGCTAAGCAAATTGGAAATGAACCAACCCCXCCAGTTCCAATTACTATATGGGGTTTGAATTCT
TTAAATATTTGGGAACTTTTAATTAGGGATTTGACGAGAACAAAAGGGAGGACGAATAXAGTTGTAGAGGAGAAAAAGGGCCGGCCTAAT
GGTGCAGCAGGAATCGGTTCAAAGGAGTATCCTGCTGTTGGCACTGCXGGTGCTTTCCATTCCAGTTTGAAGTCCAACAAAGAGAATTTG
GGCATTTGGGTCAAGGACTTTAAGGTCGTCAGCAATGGCAATCGCCGGAAAATATGGCCTCCGGTGCCCCCTGCAGCCAATATGATTCGA
AGGGTGTCAGTTGTAGCAGGTGCTTCTCCGGATGCAXTTGGTGCTTTGATTGTTGGGTTTGTTGAGAGAGAGACAGTTACTGATCTTGAG
ATTCCTAGATTGAAGTTGAATGGAGGGGCAAAAGTTAAGGATTTGGGAACGGAGAATTGGGTTTTAAAGGTACCGGCAGGCTCGGGGAAG
AGAGTGAATTAA\
Edits in Original Sequence 
TCTGCAGCTGCATATGCTAAATCCATGGAGTGCAAGAACCTTCACCAAGTTAGGATCAAATCAGATTAAAACGGAGAAAAGGATATCTCT
TTCTTAACGAAAACTTAGAAGCCTGAAATGCAAAATTTGCCATAAAGTAATACACAATTGTCTAGTCTAAATCAGGATATAAAACATTTG
CAGCTCTA
(5')ATGACAAAAGGCATTGXAGCTGTTAAAACGAAACAACACTCACGGGGTAATGXTATAATCGGGGATGAAATTTCACXG
AGGCTCTCCATCTCATCATATGCTAAGACCCCGGTTTGCCATATCAAAAACAAGTCTTTCCGTTCTTTTAACATCTCAGAATACAAATGC
AAAATAGCAACATTAAGTGCATTAGCACCCAATGAGCCTCCaAGAATCAATACCACCTTACCATCCCCCTTCCCTACAACTGCATTTGAA
AAGAAATGACGCCTTCCCAXCGGCCTTAGACGCATATTGCCTCAAAGACAATCTCACTGGATTTCCXGCACACCACgCATTTGTTCTTTT
GCCAAAAACAATCAACACTAGAATTAAATGCAACAAACACATTATATGCAAATAAAGAAAGCACCCGATTAGCGATTCCGGGTACTGaAT
TTTGTTCTTGAAXTTGCAAGTTTAATGCCTTTGAGACTTGCAGCTAAGCAAATTGGAAATGAACCAACCCCXCCAGTTCCAATTACTATA
TGGGGTTTGAATTCTTTAAATATTTGGGAACTTTTAATTAGGGATTTGACGAGAACAAAAGGGAGGACGAATAXAGTTGTAGAGaGAGAA
AAAGGGCCGGCCTAATGGTGCAGCAGGAATCGGTTCAAAGGAGTATCCTGCTGTTGGCACTGCXGGTGCTTTCCATTCCAGTTTGAAGTC
CAACAAAGAGAATTTGGGCATTTGGGTCAAGGACTTTAAGGTCGTCAGCAATGGCAATCGCCGGAtAAATATGGCCTCCGGTGCCCCCTG
CAGCCAATATGATTCGAAGGGTGTCAGTTGTAGCAGGTGCTTCTCCGGATGCAXTTGGTGCTTTGATTGTTGGGTTTGTTGAGAGAGAGA
CAGTTACTGATCTTGAGATTCCTAGATTGAAGTTGAATGGAGaGGGCAAAAGTTAAGGATTTGGGAACGGAGAATTGGGTTTTAAAGGTA
CCGGCAGGCTCGGGGAAGAGAGTGAATTAA\(3')TGGCTGGTTAACATGATTAACAAATAAATATGAAGAAAACAGAATCAAGACACAT
TTGTCTGGCTCAAAGATTGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan