ESTScan Details for Unigene SGN-U279298

Score 
508
Direction 
Forward
Predicted Peptide Sequence 
EKARKSSAEQIXPLVAALSVPKMAVWRRRGRVVEWHLRPQVPKNPVVFFDVTIGNIPAGRIKMELFADITPKTAENFRQLCTGEFRKAGV
PQGFKNCQFHRVIKDFMIQGGDFLKGDGSGCVSIYGSKFEDENFIAKHTGPGLLSMANSGPNTNGCQFFVSCAKCEWLDNKHVVFGRVVG
DGLLVVRKIENVAVGANNKPKLACVIAECGEM
Predicted Coding Sequence 
GAGAAAGCTCGCAAAAGTAGCGCAGAGCAAATTXCTCCTCTAGTCGCAGCTCTTTCAGTCCCAAAAATGGCXGTCTGGCGGCGTAGAGGA
CGGGTGGTAGAATGGCACCTAAGGCCACAAGTACCAAAAAACCCAGTTGTGTTTTTCGATGTAACAATCGGCAACATCCCTGCTGGTCGC
ATCAAGATGGAGCTCTTCGCCGATATTACTCCCAAAACTGCTGAGAATTTCAGGCAACTGTGCACGGGAGAATTTAGGAAAGCAGGAGTA
CCACAAGGCTTCAAGAATTGTCAGTTCCATAGGGTGATTAAGGACTTCATGATCCAAGGTGGTGATTTCCTAAAGGGAGATGGTAGTGGA
TGTGTTTCCATATATGGAAGCAAGTTTGAGGATGAAAACTTTATCGCCAAGCACACTGGTCCTGGCCTATTATCAATGGCAAATAGCGGA
CCAAACACTAATGGATGTCAGTTTTTTGTCTCATGTGCAAAGTGTGAGTGGCTCGACAACAAGCATGTTGTTTTTGGGCGTGTTGTTGGA
GATGGTCTTTTAGTGGTCAGGAAGATTGAGAATGTGGCTGTTGGAGCAAACAACAAACCAAAGCTTGCATGCGTGATTGCTGAATGTGGA
GAGATGTAA\
Edits in Original Sequence 
(5')GAGAAAGCTCGCAAAAGTAGCGCAGAGCAAATTXCTCCTCTAGTCGCAGCTCTTTCAGTCCCAAAAATGGCXGTCTGGCGGCGTAG
AGGACGGGTGGTAGAATGGCACCTAAGGCCACAAGTACCAAAAAACCCAGTTGTGTTTTTCGATGTAACAATCGGCAACATCCCTGCTGG
TCGCATCAAGATGGAGCTCTTCGCCGATATTACTCCCAAAACTGCTGAGAATTTCAGGCAACTGTGCACGGGAGAATTTAGGAAAGCAGG
AGTACCACAAGGCTTCAAGAATTGTCAGTTCCATAGGGTGATTAAGGACTTCATGATCCAAGGTGGTGATTTCCTAAAGGGAGATGGTAG
TGGATGTGTTTCCATATATGGAAGCAAGTTTGAGGATGAAAACTTTATCGCCAAGCACACTGGTCCTGGCCTATTATCAATGGCAAATAG
CGGACCAAACACTAATGGATGTCAGTTTTTTGTCTCATGTGCAAAGTGTGAGTGGCTCGACAACAAGCATGTTGTTTTTGGGCGTGTTGT
TGGAGATGGTCTTTTAGTGGTCAGGAAGATTGAGAATGTGGCTGTTGGAGCAAACAACAAACCAAAGCTTGCATGCGTGATTGCTGAATG
TGGAGAGATGTAA\(3')CTAGTGAAAATAAATGTACACCTAGTGATTTGAAAACACACATCTGTACCTGGTTATATTTTCTTGGCATAG
TCTAGAGGACCTGTTGAGTTGATTAATCAGCTGTTTATCAATTTCATTGACATTAATGATTAAACAGTGGACTCCTCTCTCTCCGGAATT
GTAGTGAACAAGAAAGATGTACTGGATGCAAGTGTTTCCTATGTCAAAGTACATTGGAAGATTTTTGATAAGAATGCAAGTGTGTTATCT
ATGAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan