ESTScan Details for Unigene SGN-U279340

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
PAFPPPYTTGLLISNFSGRRISPVGSPPASQLVEKKKKRKDNVELKQHSPNYFCPSKNLFVSTIFAQKRVLFRTMDKNQRVLFSSAQQIE
NSSSILSCKASLEVVNDSLSGSAVHGLSETVVGVLGGGAAGSYAGEAASQMAIKVIVLDPMVKCPASALAHQHVVGSYDDSATVEEFGKR
CGVLTVEIEHVDVATLEKLEQQGVDCQPKASTIRII
Predicted Coding Sequence 
CCAGCTTTTCCACCGCCGTATACTACCGGTCTGCTCATCTCCAACTTCTCCGGCCGCCGTATATCACCGGTAGGCTCTCCCCCAGCTTCT
CAGTTGGTGGAAAAAAAGAAGAAAAGAAAGGACAATGTTGAGCTTAAACAACACTCTCCCAACTATTTCTGTCCATCAAAGAATCTCTTT
GTTTCGACAATTTTTGCTCAAAAGAGGGTTCTTTTTCGTACCATGGACAAAAATCAGCGTGTTTTGTTCTCGTCAGCGCAGCAAATTGAG
AATAGCTCTTCTATATTGTCTTGTAAAGCTTCATTGGAAGTTGTAAATGACTCACTCAGTGGTTCAGCAGTCCATGGACTATCAGAAACG
GTTGTGGGTGTTTTGGGAGGAGGXGCAGCTGGGTCGTATGCTGGTGAAGCAGCATCCCAAATGGCAATCAAAGTGATTGTCTTGGACCCA
ATGGTGAAGTGTCCTGCTAGTGCACTAGCACATCAACATGTGGTGGGAAGCTATGATGACAGTGCCACAGTAGAAGAATTTGGGAAAAGG
TGTGGAGTACTAACGGTTGAGATTGAGCATGTTGACGTTGCCACACTTGAGAAGCTTGAGCAACAAGGTGTGGATTGTCAACCCAAGGCT
TCGACTATTCGCATCATA\
Edits in Original Sequence 
AATTCGGCACGAGGCC(5')CCAGCTTTTCCgACCGCCGTATACTACCGGTCTGCTCATCTCCAACTTCTCCGGCCGCCGTATATCACCG
GTAGGCTCTCCCCCAGCTTCTCAGTTGGTGGAAAAAAAGAAGAAAAGAAAGGACAATGTTGAGCTTAAACAACACTCTCCCAACTATTTC
TGTCCATCAAAGAATCTCTTTcGTTTCGACAATTTTTGCTCAAAAGAGGGTTCTTTTTCGTACCATGGACAAAAATCAGCGTGTTTTGTT
CTCGTCAGCGCAGCAAATTGAGAATAGCTCTTCTATATTGTCTTGTAAAGCTTCATTGGAAGTTGTAAATGACTCACTCAGTGGTTCAGC
AGTCCATGGACTATCAGAAACGGTTGTGGGTGTTTTGGGAGGAGGXGCAGCTGGGTCGTATGCTGtGTGAAGCAGCATCCCAAATGGCAA
TCAAAGTGATTGTCTTGGACCCAATGGTGAAGTGTCCTGCTAGTGCACTAGCACATCAACATGTGGTGGGAAGCTATGATGACAGTGCCA
CAGTAGAAGAATTTGGGAAAAGGTGTGGAGTACTAACGGTTGAGATTGAGCATGTTGACGTTGCCACACTTGAGAAGCTTGAGCAACAAG
GTGTGGATTGTCAACCCAAGGCTTCGACTATTCGCATCATA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan