ESTScan Details for Unigene SGN-U279367

Score 
475
Direction 
Forward
Predicted Peptide Sequence 
FPITGVCQLTELTDGFSAGKRRQGPKTYYLRYTDYLSIEFPVTFRRLPTRISSAGFPISTVAAQAPVNDVVELPLSXLPFPSSAESSTVV
CEASRTVGVLEDIMECIFLNMHYIQKNLEYWQSKAQGSNAKRAYFMICERGPYAFFNGTTQLLSDCIGEGSGMQHTYCLASSYISERINF
LSSLRYHLATFLAQIYMKVDKVGEELVKDPEKSLSSLLVDMNDLFLKLEASIGHFHX
Predicted Coding Sequence 
XATTTTCCGATCACCGGCGTTTGTCAACTCACTGAACTCACCGATGGATTCTCCGCCGGAAAACGCCGGCAAGGGCCTAAAACCTACTAT
CTCCGTTACACTGATTACCTTTCAATCGAATTTCCAGTTACTTTCCGGCGGCTTCCTACTCGAATTTCCTCAGCAGGATTTCCAATTTCT
ACCGTGGCAGCTCAGGCACCAGTAAACGACGTCGTAGAATTACCTCTCTCCXCCCTTCCTTTCCCTTCCTCCGCTGAATCTTCTACGGTT
GTTTGTGAGGCATCTAGAACTGTTGGTGTTTTGGAGGACATTATGGAATGCATCTTTCTAAATATGCATTACATCCAGAAGAACTTAGAA
TATTGGCAATCTAAAGCACAGGGATCAAATGCTAAAAGAGCATACTTCATGATATGTGAGAGAGGACCATATGCTTTTTTCAATGGCACA
ACTCAATTGTTAAGCGACTGTATTGGTGAAGGTTCTGGGATGCAACATACATATTGTTTGGCATCTTCATATATATCTGAGAGGATAAAT
TTCTTGAGTAGCTTAAGATATCATTTGGCTACATTTTTGGCACAGATCTACATGAAGGTTGATAAGGTTGGTGAGGAATTGGTCAAGGAT
CCTGAGAAGTCATTATCATCATTATTGGTTGATATGAATGATCTATTTCTGAAATTGGAGGCATCAATTGGACATTTTCATGXX\
Edits in Original Sequence 
(5')XATTTTCCGATCACCGGCGTTTGTCAACTCACTGAACTCACCGATGGATTCTCCGCCGGAAAACGCCGGCAAGGGCCTAAAACCTA
CTATCTCCGTaTACACTGATTACCTTTCgAATCGAATTTCCAGTTACTTTCCGGCGGCTTCCTACTCGAATTTCCTCAGCAGGATTTCCA
ATTTCTACCGTGGCAGCTCAGGCACCAGTAAACGACGTCGTAGAATTACCTCTCTCCXCCCTTCCTTTCCCTTCCTCCGCTGAATCTTCT
ACGGTTGTTTGTGAGGCATCTAGAACTGTTGGTGTTTTGGAGGACATTATGGAATGCATCTTTCTAAATATGCATTACATCCAGAAGAAC
TTAGAATATTGGCAATCTAAAGCACAGGGATCAAATGCTAAAAGAGCATACTTCATGATATGTGAGAGAGGACCATATGCTTTTTTCAAT
GGCACAACTCAATTGTTAAGCGACTGTATTGGTGAAGGTTCTGGGATGCAACATACATATTGTTTGGCATCTTCATATATATCTGAGAGG
ATAAATTTCTTGAGTAGCTTAAGATATCATTTGGCTACATTTTTGGCACAGATCTACATGAAGGTTGATAAGGTTGGTGAGGAATTGGTC
AAGGATCCTGAGAAGTCATTATCATCATTATTGGTTGATATGAATGATCTATTTCTGAAATTGGAGGCATCAATTGGACATTTTCATGXX
\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan