ESTScan Details for Unigene SGN-U279406

Score 
384
Direction 
Forward
Predicted Peptide Sequence 
DGGTGNLKQNVKLPNPVEASIKRHSAAPAFDAKTVXLIDKARPDIRKKLEEIKLASEAAAAETEKKRKADAEFGESGERPKGAVQEIVVH
QSELGKTGSMTIVVPDSDFHDFDKDRSEDCFRPKQIWALYDEEDGMPRLYCLIREIISVKPFKVHISYISSKTDSEFGLVNWLDSGFTKS
CGNFRVFNSEIVEHVNIFSHLLSKEKVGRGGSIXKSTQKVETFGLYIEIG
Predicted Coding Sequence 
GACGGGGGGACXGGAAATTTGAAACAAAATGTTAAGCTTCCAAATCCTGTTGAAGCTTCAATAAAAAGACATTCCGCTGCTCCTGCGTTT
GATGCCAAGACGGTTXACCTAATTGACAAGGCAAGGCCAGATATCCGCAAGAAACTGGAAGAGATCAAGTTGGCTTCAGAAGCTGCTGCT
GCAGAGACCGAGAAGAAGAGAAAGGCGGATGCCGAGTTTGGTGAATCGGGTGAGAGACCTAAAGGGGCAGTGCAGGAAATTGTTGTTCAT
CAATCAGAACTGGGGAAAACTGGATCCATGACAATAGTAGTCCCAGATTCTGACTTCCATGATTTTGACAAGGATAGGTCAGAAGATTGC
TTCAGACCTAAGCAGATATGGGCTTTATATGATGAGGAAGATGGTATGCCTCGCTTGTATTGTTTGATTCGTGAAATCATATCTGTGAAA
CCATTCAAAGTTCATATCAGCTACATAAGTTCAAAGACAGATAGCGAATTTGGGCTGGTCAATTGGTTGGATTCTGGTTTTACCAAGTCA
TGTGGAAATTTTAGGGTCTTTAACTCTGAAATTGTTGAGCATGTAAACATATTTTCTCACCTGCTAAGTAAGGAGAAAGTTGGAAGGGGA
GGTAGTATTAGXAAATCTACCCAAAAAGTGGAGACATTTGGGCTGTATATCGAAATTGGX\
Edits in Original Sequence 
(5')GACGGGGGGACXGGAAATTTGAAACAAAATGTTAAGCTTCCAAATCCTGTTGAAGCTTCAATAAAAAGACATTCCGCTGCTCCTGC
GTTTGATGCCAAGACGGTTXACCTAATTGACAAGGCAAGaGCCAGATATCCGCAAGAAACTGGAAGAGATCAAGTTGGCTTCAGAAGCTG
CTGCTGCAGAGACCGAGAAGAAGAGAAAGGCGGATGCCGAGTTTGGTGAATCGGGTGAGAGACCTAAAGGGGCAGTGCAGGAAATTGTTG
TTCATCAATCAGAACTGGGGAAAACTGGATCCATGACAATAGTAGTCCCAGATTCTGACTTCCATGATTTTGACAAGGATAGGTCAGAAG
ATTGCTTCAGACCTAAGCAGATATGGGCTTTATATGATGAGGAAGATGGTATGCCTCGCTTGTATTGTTTGATTCGTGAAATCATATCTG
TGAAACCATTCAAAGTTCATATCAGCTACATAAGTTCAAAGACAGATAGCGAATTTGGGCTGGTCAATTGGTTGGATTCTGGTTTTACCA
AGTCATGTGGAAATTTTAGGGTCTTTAACTCTGAAATTGTTGAGCATGTAAACATATTTTCTCACCTGCTAAGTAAGGAGAAAGTTGGAA
GGGGAGGTAGTATTAGXAAATCTACCCAAAAAGTGGAGACATTTGGGCTGTATATCGAAATTGGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan