ESTScan Details for Unigene SGN-U279412

Score 
259
Direction 
Reverse
Predicted Peptide Sequence 
RVYDEFVEKPKVSCLLXRIVGDPFQEGSEQXPQIDTEQFEKILKLHKIWYLKGGYXTLESGGEKLGSKGFYVQPTVFSNVQDNMLIARDE
IFGPVQSLLKFKDVEEVIXRANSSHYGLAAGVFTQNIDAANTISRALRVGTVRLTAXNIFDAAIPFGGYKMCGHGREKGVYXPKYYLQVK
AIVTPLKNPTWL
Predicted Coding Sequence 
XXAAGAGTATATGATGAATTTGTGGAGAAACCCAAGGTTTCGTGCCTTTTAANACGTATCGTTGGAGACCCTTTTCAAGAAGGGAGTGAA
CAAGXTCCTCAGATTGATACAGAGCAATTTGAGAAGATCCTTAAGTTACATAAAATCTGGTACCTGAAAGGGGGCTACTTXACTCTTGAG
TCTGGAGGGGAAAAATTGGGTTCCAAGGGATTCTATGTCCAACCTACTGTCTTCTCAAATGTCCAGGATAACATGCTGATTGCCAGAGAT
GAGATATTTGGACCAGTGCAGTCCCTCTTGAAATTCAAGGATGTTGAAGAGGTCATTTGAAGGGCAAACTCGTCACATTATGGGTTGGCG
GCGGGTGTTTTTACCCAGAATATAGATGCAGCCAACACAATATCTCGAGCCCTTAGAGTAGGGACAGTGAGGTTAACTGCTTTXAATATC
TTTGATGCTGCCATTCCTTTTGGTGGTTATAAGATGTGTGGACATGGAAGAGAAAAGGGAGTCTACAXGCCTAAGTACTACTTGCAAGTC
AAAGCTATTGTTACTCCTCTGAAGAATCCAACATGGCTGTAG\
Edits in Original Sequence 
(5')XXAAGAGTATATGATGAATTTGTGGAGAAACCCAAGGTTTCGTGCCTTTTAANACGTATCGTTGGAGACCCTTTTCAAGAAGGGAG
TGAACAAGXTCCTCAGATTGATACAGAGCAATTTGAGAAGATCCTTAAGTTACATAAAATCTGGTACCTGAAAGGGGGCTACTTXACTCT
TGAGTCTGGAGGGGAAAAATTGGGTTCCAAGGGATTCTATGTCCAACCTACTGTCTTCTCAAATGTCCAGGATAACATGCTGATTGCCAG
AGATGAGATATTTGGACCAGTGCAGTCCCTCTTGAAATTCAAGGATGTTGAAGAGGTCATTTGAAGGGCAAACTCGTCACATTATGGGTT
GGCGGCGGGTGTTTTTACCCAGAATATAGATGCAGCCAACACAATATCTCGAGCCCTTAGAGTAGGGACAGTGtAGGTTAACTGCTTTXA
ATATCTTTGATGCTGCCATTCCTTTTGGTGGTTATAAGATGTGTGGACATGGAAGAGAAAAGGGAGTCTACAXGCCTAAGTACTACTTGC
AAGTCAAAGCTATTGTTACTCCTCTGAAGAATCCAACATGGCTGTAG\(3')TTTTCCCTCCTGCTTTCTGATACTCCTGAGATGTCATG
CAACACGGCAATCTTGTTTTTTTGAGGTCACTTGTATACAGTGTAGATAAGACCAAAACGCTATATTGTGTTTGTGTTATTGTTTGTTAC
TAACTTTTTATGATTTGATAACAATATGCAACCTTGTTTGTGTGAAACCTTTCTTGTATTTCTGTAGCTCTGATGCAAAATAGGATCTTG
TTTTTGAGTTTTGTGGGAATGTAATGAATTGATAGATAGATGCAATGTTATACTTCTATATTAGAAAGGTATATATCTAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan