Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U279451

Score 
304
Direction 
Forward
Predicted Peptide Sequence 
ADGSVKFGFEEGSAYLIDPDIYTDGRISVQGIDGVLFPVEDIKVAPKSAPVVAAGDAKVVAKXKKRKVDGSSM
Predicted Coding Sequence 
GCTGATGGGTCTGTGAAATTCGGGTTTGAAGAAGGATCGGCGTATTTGATTGATCCGGATATTTATACCGACGGGAGGATTTCCGTTCAG
GGGATTGACGGAGTTCTTTTTCCGGTGGAGGATATTAAGGTGGCTCCAAAATCTGCTCCTGTTGTTGCTGCTGGTGATGCTAAAGTTGTT
GCTAAAXCAAAGAAGAGGAAAGTTGATGGAAGTAGCATGTAG\
Edits in Original Sequence 
(5')GCTGATGGGTCTGTGAAATTCGGGTTTGAAGAAGGATCGGCGTATTTGATTGATCCGGATATTTATACCGACGGGAGGATTTCCGT
TCAGGGGATTGACGGAGTTCTTTTTCCGGTGGAGGATATTAAGGTGGCTCCAAAATCTGCTCCTGTTGTTGCTGCTGGTGATGCTAAAGT
TGTTGCTAAAXCAAAGAAGAGGAAAGTTGATGGAAGTAGCATGTAG\(3')TATGATGGGGTCATTTTGTCATTAAAATTCAAGATCAAG
AAATTGAATTATGAAGATGGTAATTCAGTTAGGATTTGGGGAGAAGAGGAAAAAAAATAAAAAGCTACAAAATTTTCTGAATAAATGGCA
AATTTTTAATATTTTTTTTTCTAGTAGAGCCTTGTAAAATTTAGGGAAGGAGAAAAAAAAATGCTTGAATTGAAGTAAAAATTCAGAAAA
AGTGAATTTTCTCCTCTTTTTTTTTTTTTGGGTTTTGTTATAAAAAGTGTAATTACTACATATCAATTTTTTATTTGTATTTAAGGTTTG
TTGGTACCAAACACTTTGTATGCACAAATATACCGTCTTTTTTGTCCTTTTATAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan