ESTScan Details for Unigene SGN-U279528

Score 
290
Direction 
Reverse
Predicted Peptide Sequence 
AIPQKANDXILSVKLNVADIEATLSRVCQMVLQDNNVKKEELRARAKGLKTLGKIFQKVKSVNEVETTENGVHKLDGNEPSYDSRSSTAS
VPSQNREEVPYTVFASQSPYVEAPQFTSGQSSYNFPMPTAPPGAXETQVDRQMVDAA
Predicted Coding Sequence 
XATGCAATCCCACAAAAAGCTAATGATXTGATTCTCTCTGTGAAGCTTAATGTAGCAGATATTGAAGCCACTCTTTCTCGTGTTTGTCAA
ATGGTTCTACAAGACAACAACGTAAAGAAAGAAGAGCTTCGTGCTCGCGCAAAGGGGTTGAAGACTCTCGGCAAAATTTTTCAGAAGGTT
AAGTCAGTCAATGAAGTCGAAACTACAGAAAACGGCGTCCACAAGTTGGACGGAAATGAACCAAGCTACGACTCTCGTTCTTCAACTGCA
TCAGTACCATCTCAAAATAGAGAAGAGGTGCCTTATACAGTATTTGCATCTCAGAGCCCATATGTGGAGGCTCCACAGTTTACCAGTGGT
CAATCCAGCTATAACTTCCCCATGCCGACTGCACCACCAGGTGCAXCAGAGACACAGGTAGACAGACAAATGGTGGACGCCGCATGA\
Edits in Original Sequence 
(5')XATGCAATCCCACAAAAAGCTAATGATXTGATTCTCTCTGTGAAGCTTAATGTAGCAGATATTGAAGCCACTCTTTCTCGTGTTTG
TCAAATGGTTCTACAAGACAACAACGTAAAGAAAGAAGAGCTTCGTGCTCGCGCAAAGGGGTTGAAGACTCTCGGCAAAATTTTTCAGAA
GGTTAAGTCAGTCAATGAAGTCGAAACTACAGAAAACGGCGTCCACAAGTTGGACGGAAATGAACCAAGCTACGACTCTCGTTCTTCAAC
TGCATCAGTACCATCTCAAAATAGAGAAGAGGTGCCTTATACAGTATTTGCATCTCAGAGCCCATATGTGGAGGCTCCACAGTTTACCAG
TGGTCAATCCAGCTATAACTTCCCCATGCCGACTGCACCACCAGGTGCAXCAGAGACACAGGTAGACAGACAAATGGTGGACGCCGCATG
A\(3')ATGTGTAGCTTGTGAATTTGTAGTGCTTGTTGGTATTTGCTTATTCTTAGGGAGAAAAAGAGGGAGTTTGAGTTTCTTATGTAT
CCCTAGTGTGCTATATTTAAAGCATGATTCTTGCTTAGCAGAGAAAAGCTTACTGTCATATTGCTTTCATGAAGGACTGCTTTGTAATTA
ATATAGTTAGAGTGTAAGTTGTGTGGCCTGTGAATGCAAAATATTGTATATTGCATTGGTCTATTCTTCTTGTTGTATTAACCAATTTAA
TGTTTTTGTTATTGACTATTTTGCCAACTCCCTAGTTGGTGTCTTTTTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan