ESTScan Details for Unigene SGN-U279571

Score 
553
Direction 
Forward
Predicted Peptide Sequence 
MAHRRSKLLILLCCLSYTLSIAIAAKSYYDILQIPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEISNAYEVISDSEKRNIYDR
YGEEGLKQHAASGGRGGGMNMQDIFSQFFGGGSMEEEEEKIVKGDDVIVDLDATLEDLYMGGXLGGLEGEKRFKPASX
Predicted Coding Sequence 
ATGGCGCATAGAAGATCAAAGTTGCTCATCTTGTTGTGTTGTTTATCGTACACTTTGTCAATTGCCATTGCTGCGAAGAGTTACTATGAT
ATTTTGCAAATTCCAAAAGGTGCTTCGGATGAACAGATCAAACGAGCTTATCGGAAGCTTGCGTTGAAGTATCACCCTGATAAGAATCAG
GGAAATGAAGAGGCTAATAAGAAATTTGCTGAAATCAGTAACGCTTATGAAGTTATTTCGGACAGTGAAAAGAGAAATATATATGATCGG
TATGGGGAAGAGGGTCTTAAACAACATGCTGCTAGCGGAGGCAGAGGTGGTGGAATGAACATGCAAGACATATTTAGCCAGTTTTTCGGT
GGGGGCTCAATGGAGGAGGAGGAAGAGAAGATTGTGAAAGGTGATGATGTAATTGTTGATTTGGATGCTACATTGGAAGACTTATACATG
GGGGGCXTCCTTGGAGGTTTGGAGGGAGAAAAACGTTTTAAGCCGGCTTCTGXX\
Edits in Original Sequence 
ATTCACCTCAATCCATGGACAAATTCATATTCATAAATTCTGCGCAAATTCTAGATTGTTCTAGTAGATCCAGTTAACGAAAACCCGAAG
CTATCGATTCAATCTCTCTGGTTGTGAGAAATAATTTTTGATTCCTTAGATCTGTGTGCCTAACGAGTT
(5')ATGGCGCATAGAAGATC
AAAGTTGCTCATCTTGTTGTGTTGTTTATCGTACACTTTGTCAATTGCCATTGCTGCGAAGAGTTACTATGATATTTTGCAAATTCCAAA
AGGTGCTTCGGATGAACAGATCAAACGAGCTTATCGGAAGCTTGCGTTGAAGTATCACCCTGATAAGAATCAGGGAAATGAAGAGGCTAA
TAAGAAATTTGCTGAAATCAGTAACGCTTATGAAGTTATTTCGGACAGTGAAAAGAGAAATATATATGATCGGTATGGGGAAGAGGGTCT
TAAACAACATGCTGCTAGCGGAGGCAGAGGTGGTGGAATGAACATGCAAGACATATTTAGCCAGTTTTTCGGTGGGGGCTCAATGGAGGA
GGAGGAAGAGAAGATTGTGAAAGGTGATGATGTAATTGTTGATTTGGATGCTACATTGGAAGACTTATACATGGGGGGCXTCCTTGGAGG
TTTGGAGGGAGAAAAACGTTTTAAGCCGGCTTCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan