ESTScan Details for Unigene SGN-U279616

Score 
876
Direction 
Forward
Predicted Peptide Sequence 
IFFFTKEKIGKMGDFNSKKSNKVNFETKIQELQEIVIGKEGLRKKILQKGNSWKTPFHGDEIQVHYRVKLQDGEFFDSSYDRGKPFTFKL
GQGEVIKGWDEGIATMKKSERAIFTIPPNLAYGEIGSPPLIPPNSTLIFEIELISWNSIRDISGDGGILKKIIKEGQGWATPRDVDEVLV
KYAASSADGNILSQYDDAVEFSLMEGHVYPAMKKSIKTMRKGEIVELTVKPAYYFGNSSFDGDGIGILQSSNSNLIIHLELISWKSVVDV
IG
Predicted Coding Sequence 
XTTATCTTCTTTTTCACTAAAGAGAAAATAGGGAAAATGGGGGATTTTAATTCTAAGAAAAGTAACAAAGTGAATTTTGAAACTAAAATT
CAAGAATTACAAGAGATTGTAATTGGGAAAGAAGGCTTGAGAAAAAAGATTTTGCAAAAGGGTAATTCTTGGAAGACACCATTTCATGGT
GATGAAATCCAAGTTCATTACAGAGTGAAACTTCAAGATGGAGAATTTTTTGACTCAAGCTATGATAGAGGAAAGCCTTTTACATTCAAG
CTAGGTCAAGGTGAAGTTATTAAAGGATGGGATGAAGGAATTGCAACAATGAAAAAGAGTGAAAGAGCAATATTCACAATTCCACCAAAT
TTGGCTTATGGAGAAATTGGTTCACCCCCTTTAATTCCTCCAAATTCAACACTTATTTTTGAAATAGAATTAATTTCTTGGAATTCAATT
AGAGATATTAGTGGAGATGGAGGAATATTGAAAAAAATAATTAAAGAAGGTCAAGGATGGGCAACACCTAGAGATGTAGATGAAGTACTA
GTGAAGTATGCAGCAAGCTCTGCAGATGGAAACATTCTATCACAATATGATGATGCTGTTGAGTTTTCTTTAATGGAAGGCCATGTATAT
CCAGCCATGAAGAAATCTATAAAGACAATGAGAAAAGGAGAAATAGTTGAGTTAACTGTGAAGCCAGCTTATTATTTTGGAAATTCAAGT
TTTGATGGTGATGGAATTGGAATATTGCAATCATCAAATTCCAATTTGATAATTCATCTTGAGTTGATTTCATGGAAAAGTGTTGTTGAT
GTTATTGGA\
Edits in Original Sequence 
(5')XTTATCTTCTTTTTCACTAAAGAGAAAATAGGGAAAATGGGGGATTTTAATTCTAAGAAAAGTAACAAAGTGAATTTTGAAACTAA
AATTCAAGAATTACAAGAGATTGTAATTGGGAAAGAAGGCTTGAGAAAAAAGATTTTGCAAAAGGGTAATTCTTGGAAGACACCATTTCA
TGGTGATGAAATCCAAGTTCATTACAGAGTGAAACTTCAAGATGGAGAATTTTTTGACTCAAGCTATGATAGAGGAAAGCCTTTTACATT
CAAGCTAGGTCAAGGTGAAGTTATTAAAGGATGGGATGAAGGAATTGCAACAATGAAAAAGAGTGAAAGAGCAATATTCACAATTCCACC
AAATTTGGCTTATGGAGAAATTGGTTCACCCCCTTTAATTCCTCCAAATTCAACACTTATTTTTGAAATAGAATTAATTTCTTGGAATTC
AATTAGAGATATTAGTGGAGATGGAGGAATATTGAAAAAAATAATTAAAGAAGGTCAAGGATGGGCAACACCTAGAGATGTAGATGAAGT
ACTAGTGAAGTATGCAGCAAGCTCTGCAGATGGAAACATTCTATCACAATATGATGATGCTGTTGAGTTTTCTTTAATGGAAGGCCATGT
ATATCCAGCCATGAAGAAATCTATAAAGACAATGAGAAAAGGAGAAATAGTTGAGTTAACTGTGAAGCCAGCTTATTATTTTGGAAATTC
AAGTTTTGATGGTGATGGAATTGGAATATTGCAATCATCAAATTCCAATTTGATAATTCATCTTGAGTTGATTTCATGGAAAAGTGTTGT
TGATGTTATTGGA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan