ESTScan Details for Unigene SGN-U279681

Score 
213
Direction 
Forward
Predicted Peptide Sequence 
RSATLEAAPASGGVAPAISLTDNALMHLNKMRNDRNEDLCLRIGVKQGGCSGMSYTMEFEKRENARPDDSFIEYNGFVIVCDPKSLLFIF
GMQLDYSDALIGGGFSFKNPNATQTCGCGKSFTAEMKSMXVLEMYYNITYLNTNCSLFGPLDIDRQ
Predicted Coding Sequence 
CGATCTGCTACACTTGAAGCAGCACCTGCATCTGGAGGAGTAGCACCTGCAATTTCCTTAACCGACAATGCATTAATGCACTTGAATAAA
ATGAGGAATGATCGGAATGAGGACTTGTGTCTTAGAATTGGCGTTAAACAAGGGGGATGCTCGGGAATGTCATACACGATGGAGTTTGAA
AAGCGAGAAAATGCTAGACCAGACGATTCATTCATTGAGTACAATGGATTTGTTATTGTTTGTGATCCAAAAAGCCTTCTCTTCATCTTC
GGAATGCAACTGGACTACAGCGATGCATTGATAGGCGGGGGCTTCTCTTTCAAAAATCCAAATGCTACGCAAACTTGTGGTTGTGGAAAA
TCGTTTACTGCTGAGATGAAGAGCATGTAXGTCTTAGAAATGTACTACAACATCACATACTTGAACACCAACTGTAGTTTGTTTGGTCCT
CTAGATATCGACAGACAGTAA\
Edits in Original Sequence 
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGCGCCTTCGTTTTTTAATCGCAAAAAAACATTGTCTATT(5')CGATCTGCTACACTTGA
AGCAGCACCTGCATCTGGAGGAGTAGCACCTGCAATTTCCTTAACCGACAATGCATTAATGCACTTGAATAAAATGAGGAATGATCGGAA
TGAGGACTTGTGTCTTAGAATTGGCGTTAAACAAGGGGGATGCTCGGGAATGTCATACACGATGGAGTTTGAAAAGCGAGAAAATGCTAG
ACCAGACGATTCATTCATTGAGTACAATGGATTTGTTATTGTTTGTGATCCAAAAAGCCTTCTCTTCATCTTCGGAATGCAACTGGACTA
CAGCGATGCATTGATAGGCGGGGGCTTCTCTTTCAAAAATCCAAATGCTACGCAAACTTGTGGTTGTGGAAAATCGTTTACTGCTGAGAT
GtAAGAGCATGTAXGTCTTAGAAATGTACTACAACATCACATACTTGAACACCAACTGTAGTTTGTTTGGTCCTCTAGATATCGACAGAC
AGTAA\(3')TGAAGATATGTTAAATCATATTATGTGCATAAGGGACTGTAACTTTTAAATATGTGTAACTGGGAATGCATTTTATTCTT
CCTGCACAAAATACTAAACATCTATGCCATGTCGATTTATGCTTCGTGGGGCAGAGCCGCAAGGTAACACATGAACTCAAATAGTTTTTG
CCCGGATTTTGTATATGGATTTTTAAAACATTATTGAATTTATATAAATGATGTGAATTCAGTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan