ESTScan Details for Unigene SGN-U279773

Score 
357
Direction 
Forward
Predicted Peptide Sequence 
GSADEMEGDIGGDPFWVLRIIGYPAASISNGHDKAHDDVGCGAHTDYGLLTLVNQDDDIVALQVRNKSGEWISAPPIPGTFVCNIGDMLK
IISNGIYESTLHRVINNSPKYRVCVAYFYEPNFDAAVEPLDVCLHKTGGTKNFEGAVYGKHLVSKVTTNFTXVEIEPSLKK
Predicted Coding Sequence 
XXTGGATCAGCTGATGAAATGGAGGGTGACATTGGTGGTGATCCATTTTGGGTCTTGCGAATAATTGGTTACCCTGCTGCGTCCATTTCA
AATGGACATGATAAGGCTCACGATGATGTTGGATGTGGCGCCCATACAGACTATGGGCTATTGACATTAGTCAACCAGGATGACGATATA
GTTGCCCTTCAGGTGAGAAATAAATCGGGCGAGTGGATATCAGCACCACCTATCCCTGGCACATTTGTATGCAATATAGGAGATATGTTG
AAGATCATATCAAACGGAATTTATGAATCAACTTTGCACCGGGTCATCAATAACTCTCCCAAATATCGTGTTTGTGTGGCCTACTTTTAT
GAGCCTAACTTCGATGCTGCAGTAGAGCCACTGGATGTGTGTTTACACAAGACTGGTGGCACCAAGAATTTTGAAGGAGCTGTTTACGGG
AAGCATTTGGTCAGCAAAGTCACCACCAATTTTACTXATGTAGAGATTGAGCCAAGTCTGAAAAAGTGA\
Edits in Original Sequence 
(5')XXTGGATCAGCTGATGAAATGGAGGGTGACATTGGTGGTGATCCATTTTGGGTCTTGCGAATAATTGGTTACCCTGCTGCGTCCAT
TTCAAATGGACATGATAAGGCTCACGATGATGTTGGATGTGGCGCCCATACAGACTATGGGCTATTGACATTAGTCAACCAGGATGACGA
TATAGTTGCCCTTCAGGTGAGAAATAAATCGGGCGAGTGGATATCAGCACCACCTATCCCTGGCACATTTGTATGCAATATAGGAGATAT
GTTGAAGATCATATCAAACGGAATTTATGAATCAACTTTGCACCGGGTCATCAATAACTCTCCCAAATATCGTGTTTGTGTGGCCTACTT
TTATGAGCCTAACTTCGATGCTGCAGTAGAGCCACTGGATGTGTGTTTACACAAGACTGGTGGCACCAAGAATTTTGAAGGAGCTGTTTA
CGGGAAGCATTTGGTCAGCAAAGTCACCACCAATTTTACTXATGTAGAGATTGAGCCAAGTCTGAAAAAGTGA\(3')ATGGAATAAAAA
TAAGGTTGTATTCCCTTGAAAATAATGACATATCCAGTGTAATCTCATGAGATGAAGGTTGTTTTCAAAAGGCCCTCAGATTAAGTAAGT
GAGTAAAGCAATATTATTTGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan