ESTScan Details for Unigene SGN-U279819

Score 
1015
Direction 
Forward
Predicted Peptide Sequence 
MAPTKEEERKLQEFKDESPFKLGPAEKFLKAVLYIPFAFNRVEAMLYIANFDSEIEYLKRSFETLETASEELRNSRMFLKLLEAVLKTGN
RMNVGTNRGDACAFKLDTLLKLVDIKGADGKTTLLHFVVQEIIRAEGSRLSGADDQNPIVEKTLQDEVEFRKIGLQVVSRLSGELTNVKK
AAAMDSDIISNEVAKLAAGIAKITNVLKLNKELVPSENSRKFSESMNGFLKTAEQEIINIQAQESVALSMVKEVTVYFHGDSAKEEARPL
RIFMVVRDFLSILDQVCKDVGRMTDEPQSAQVDNFPXTVDAGLPQVFPGYNVRQHDSSSEDETTPSGHDIVLSDDFLRP
Predicted Coding Sequence 
ATGGCTCCCACTAAAGAAGAAGAGCGGAAGCTGCAAGAGTTTAAAGATGAATCACCATTCAAGTTAGGCCCAGCCGAGAAGTTTCTCAAG
GCAGTGCTTTATATCCCTTTTGCATTTAATAGGGTGGAGGCTATGCTATATATTGCAAACTTTGATTCAGAGATTGAATATCTTAAGAGG
TCATTTGAAACACTAGAGACTGCTAGTGAAGAGCTAAGGAATAGTAGGATGTTTCTAAAGCTACTAGAGGCTGTACTCAAAACAGGGAAC
CGCATGAATGTTGGAACCAACAGAGGAGATGCCTGTGCATTCAAGCTCGACACACTTCTTAAGCTTGTAGATATTAAAGGTGCTGATGGG
AAGACCACACTACTGCATTTTGTTGTTCAGGAAATCATCAGAGCAGAAGGGTCTCGTCTTTCTGGTGCTGATGATCAGAATCCAATTGTA
GAAAAGACACTGCAGGATGAGGTTGAATTCAGAAAGATTGGCCTTCAAGTTGTTTCTCGCCTAAGTGGTGAGCTTACAAATGTGAAGAAA
GCTGCTGCTATGGACTCTGATATTATTAGCAATGAAGTTGCAAAACTAGCTGCAGGAATTGCTAAGATCACTAATGTTCTTAAGCTGAAC
AAAGAGTTGGTGCCGAGTGAGAATAGCAGAAAATTTTCTGAGTCAATGAATGGATTCTTGAAGACGGCAGAGCAAGAAATTATCAACATC
CAAGCTCAAGAGAGTGTTGCCCTCTCAATGGTGAAGGAGGTGACAGTATATTTCCATGGTGACTCTGCCAAGGAAGAAGCTCGGCCACTT
AGAATATTCATGGTAGTAAGGGACTTCCTCTCTATCCTCGATCAGGTGTGCAAAGATGTCGGGAGAATGACTGACGAACCACAATCAGCT
CAGGTAGACAATTTCCCTXTGACAGTCGATGCAGGGCTTCCCCAAGTTTTTCCTGGATACAACGTAAGGCAACACGATAGCTCCTCTGAG
GATGAAACAACCCCATCTGGTCATGACATAGTGTTATCAGATGACTTCCTTCGCCCATAA\
Edits in Original Sequence 
GTTACTTGAGAGTTTATTGAAG(5')ATGGCTCCCACTAAAGAAGAAGAGCGGAAGCTGCAAGAGTTTAAAGATGAATCACCATTCAAGT
TAGGCCCAGCCGAGAAGTTTCTCAAGGCAGTGCTTTATATCCCTTTTGCATTTAATAGGGTGGAGGCTATGCTATATATTGCAAACTTTG
ATTCAGAGATTGAATATCTTAAGAGGTCATTTGAAACACTAGAGACTGCTAGTGAAGAGCTAAGGAATAGTAGGATGTTTCTAAAGCTAC
TAGAGGCTGTACTCAAAACAGGGAACCGCATGAATGTTGGAACCAACAGAGGAGATGCCTGTGCATTCAAGCTCGACACACTTCTTAAGC
TTGTAGATATTAAAGGTGCTGATGGGAAGACCACACTACTGCATTTTGTTGTTCAGGAAATCATCAGAGCAGAAGGGTCTCGTCTTTCTG
GTGCTGATGATCAGAATCCAATTGTAGAAAAGACACTGCAGGATGAGGTTGAATTCAGAAAGATTGGCCTTCAAGTTGTTTCTCGCCTAA
GTGGTGAGCTTACAAATGTGAAGAAAGCTGCTGCTATGGACTCTGATATTATTAGCAATGAAGTTGCAAAACTAGCTGCAGGAATTGCTA
AGATCACTAATGTTCTTAAGCTGAACAAAGAGTTGGTGCCGAGTGAGAATAGCAGAAAATTTTCTGAGTCAATGAATGGATTCTTGAAGA
CGGCAGAGCAAGAAATTATCAACATCCAAGCTCAAGAGAGTGTTGCCCTCTCAATGGTGAAGGAGGTGACAGTATATTTCCATGGTGACT
CTGCCAAGGAAGAAGCTCGGCCACTTAGAATATTCATGGTAGTAAGGGACTTCCTCTCTATCCTCGATCAGGTGTGCAAAGATGTCGGGA
GAATGACTGAcCGAACCACAATCAGCTCAGGTAGACAATTTCCCTXTGACAGTCGATGCAGGGCTTCCCCAAGTTTTTCCTGGATACAAC
GTAAGGCAACACGATAGCTCCTCTGAGGATGAAACAACCCCATCTGcGTCATGACATAGTGTTATCAGATGACTTCCTTCGCCCATAA\
(3')TAGGCTGGTTTATTTCCACTGTATAGTTTGCTGGAGCCTATGGATTGGTCTTTTTGATGTCCCAAGTGTAGTAGATATCAGTCTTGC
ATTTCTCATCTGTATTTATACCTTTTCTGTAGTTGCATTCTAGAGCTATCTTATTATAATTTTATTGGTAACCGCTCTTTTTTTAATGAT
TGTAATATAAGGAAGTACAAGTATATCAGGGATTATCATTCATGATATTTGATCACGAGACCATAAATATAAGGCGAAATGATTTGGTGG
ACCTTTGTACTTGTATCTGTTTGTATTGTGAACCCTTCTATTTACCCTTTTGTCATCTGGACCCTTGAATCCATCCAAACCCAATATTTT
GAAAAAAGTTTTTGATGTGGTATGGTGCGTGTTGCACAAACTTTGTTGAGAGGCCAAAAATAAAAATAAAAAATTCACGTAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan