ESTScan Details for Unigene SGN-U279821

Score 
561
Direction 
Forward
Predicted Peptide Sequence 
LLEGQLRKQRQNKVFAISRIEILGGTTNGRLSSVEKKTNGSISENIEEFESNNYLRRLVRNGELEESFKHLESMVYRGDIPDIIPCTSLI
RGFCRIGQTKKATRVLEILEDSGAVPDVITYNVLISGYCKSGEIDNALKVLDRMSVAPDVVTYNTILRSLCDSGKLKQAMHVLDCMLQKE
CYPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCVPDVVTYNVLINGICKEGRLNEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGR
WMDAEKLLADMVRKGCSPSVVTFNILINFLCRKGLLGRAIDLLEKMPKYGCTPNSLSYNPLLHAFCKEKKMDRAIEYLEVMVSRGCYPDI
VTYNTLLTALCKDGKVDVAVEILNQLSDKGCSPVLITYNTVIDGLSKVGKTELAIELLNEMR
Predicted Coding Sequence 
XATTTGCTTGAGGGTCAGTTGAGGAAACAGAGACAAAATAAGGTTTTTGCTATTTCAAGAATTGAAATTTTAGGAGGGACGACGAATGGT
AGGTTATCAAGTGTTGAGAAAAAGACAAATGGGAGCATATCTGAAAATATTGAAGAATTTGAGAGTAATAATTATCTTCGTAGGTTGGTT
AGGAATGGGGAATTAGAAGAAAGCTTTAAGCATCTTGAGAGTATGGTGTATCGTGGGGATATACCTGATATTATACCATGTACGAGTTTG
ATTCGTGGGTTTTGTAGAATTGGGCAAACGAAGAAGGCTACGAGGGTTTTGGAGATTCTTGAGGATTCTGGGGCTGTTCCTGATGTTATT
ACTTACAATGTACTGATTAGTGGTTATTGTAAGTCGGGTGAAATTGATAATGCGTTGAAGGTATTGGATCGAATGAGTGTTGCACCTGAT
GTTGTCACGTACAATACTATTTTGCGTAGCTTATGTGATAGTGGGAAATTGAAACAAGCTATGCATGTTCTTGACTGTATGTTGCAGAAA
GAGTGTTACCCTGATGTGATTACCTATACAATTTTGATCGAAGCAACGTGTAAGGAAAGTGGTGTTGGGCAGGCGATGAAGCTTTTGGAT
GAAATGAGGAGTAAAGGATGTGTTCCTGATGTAGTAACTTATAATGTTCTTATAAATGGGATTTGTAAGGAAGGGAGATTGAACGAAGCA
ATCAAGTTTCTGAATAATATGCCATCTTATGGTTGCCAACCTAATGTGATTACCCACAATATAATTTTGCGTAGTATGTGTAGTACAGGT
AGGTGGATGGATGCCGAGAAACTGTTGGCTGATATGGTTAGAAAAGGGTGTTCTCCTAGTGTTGTCACGTTTAACATCTTGATCAATTTC
TTATGTCGGAAGGGACTGTTGGGACGGGCGATTGATTTATTGGAGAAGATGCCTAAGTATGGATGTACGCCAAACTCCTTGAGTTATAAT
CCATTGCTTCATGCATTCTGCAAAGAGAAGAAAATGGATAGAGCAATTGAGTATTTGGAAGTTATGGTGAGTAGGGGTTGTTACCCTGAT
ATTGTGACTTATAATACATTGCTCACGGCTTTGTGCAAAGATGGTAAGGTTGATGTTGCAGTTGAAATCCTCAATCAACTTAGCGACAAA
GGCTGTTCTCCAGTTCTAATCACTTACAATACAGTGATTGATGGATTATCCAAAGTTGGGAAAACTGAACTTGCCATTGAACTTCTGAAT
GAAATGCGX\
Edits in Original Sequence 
(5')XATTTGCTTGAGGGTCAGTTGAGGAAACAGAGACAAAATAAGGTTTTTGCTATTTCAAGAATTGAAATTTTAGGAGGGACGACGAA
TGGTAGGTTATCAAGTGTTGAGAAAAAGACAAATGGGAGCATATCTGAAAATATTGAAGAATTTGAGAGTAATAATTATCTTCGTAGGTT
GGTTAGGAATGGGGAATTAGAAGAAAGCTTTAAGCATCTTGAGAGTATGGTGTATCGTGGGGATATACCTGATATTATACCATGTACGAG
TTTGATTCGTGGGTTTTGTAGAATTGGGCAAACGAAGAAGGCTACGAGGGTTTTGGAGATTCTTGAGGATTCTGGGGCTGTTCCTGATGT
TATTACTTACAATGTACTGATTAGTGGTTATTGTAAGTCGGGTGAAATTGATAATGCGTTGAAGGTATTGGATCGAATGAGTGTTGCACC
TGATGTTGTCACGTACAATACTATTTTGCGTAGCTTATGTGATAGTGGGAAATTGAAACAAGCTATGCATGTTCTTGACTGTATGTTGCA
GAAAGAGTGTTACCCTGATGTGATTACCTATACAATTTTGATCGAAGCAACGTGTAAGGAAAGTGGTGTTGGGCAGGCGATGAAGCTTTT
GGATGAAATGAGGAGTAAAGGATGTGTTCCTGATGTAGTAACTTATAATGTTCTTATAAATGGGATTTGTAAGGAAGGGAGATTGAACGA
AGCAATCAAGTTTCTGAATAATATGCCATCTTATGGTTGCCAACCTAATGTGATTACCCACAATATAATTTTGCGTAGTATGTGTAGTAC
AGGTAGGTGGATGGATGCCGAGAAACTGTTGGCTGATATGGTTAGAAAAGGGTGTTCTCCTAGTGTTGTCACGTTTAACATCTTGATCAA
TTTCTTATGTCGGAAGGGACTGTTGGGACGGGCGATTGATTTATTGGAGAAGATGCCTAAGTATGGATGTACGCCAAACTCCTTGAGTTA
TAATCCATTGCTTCATGCATTCTGCAAAGAGAAGAAAATGGATAGAGCAATTGAGTATTTGGAAGTTATGGTGAGTAGGGGTTGTTACCC
TGATATTGTGACTTATAATACATTGCTCACGGCTTTGTGCAAAGATGGTAAGGTTGATGTTGCAGTTGAAATCCTCAATCAACTTAGCGA
CAAAGGCTGTTCTCCAGTTCTAATCACTTACAATACAGTGATTGATGGATTATCCAAAGTTGGGAAAACTGAACTTGCCATTGAACTTCT
GAATGAAATGCGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan