ESTScan Details for Unigene SGN-U280055

Score 
326
Direction 
Forward
Predicted Peptide Sequence 
RQNPECMDVKGPKPQIPKLPPGNVPNSPETAVSRPSPPLRRHKLTVPRQVTKPITNIIFNFSISTSALTIKSSSTRAAANSGKFISPFTS
LAPLKPYLLSEWKPILCGWLCSVLSVYSLSKIVPKVGKFSSLMNPLDVVRLREECLVLGGLFFVRLVGNYLQQAFLWEAALNCVYKMRVC
VFHKVLQRDLXFFEGENGIAAGDVAYRITA
Predicted Coding Sequence 
AGGCAAAATCCXGAGTGTATGGATGTTAAGGGACCAAAACCGCAAATACCTAAATTACCACCGGGAAATGTCCCTAATTCACCTGAAACC
GCCGTATCACGGCCGTCGCCGCCCCTTCGCCGCCACAAACTCACAGTCCCCCGCCAGGTAACCAAACCAATTACTAACATCATCTTCAAT
TTCTCCATTTCCACCTCTGCCTTAACAATAAAATCATCATCTACACGCGCCGCTGCGAACTCCGGCAAGTTCATTTCTCCGTTCACCTCT
TTAGCTCCTCTTAAACCTTATCTCCTTTCGGAATGGAAACCGATTCTCTGTGGATGGCTCTGCAGTGTTTTATCTGTTTACTCTCTGTCC
AAAATTGTTCCCAAAGTTGGAAAATTCTCGTCTCTCATGAATCCGTTGGATGTTGTGAGGCTGAGAGAGGAGTGTTTGGTTTTGGGAGGT
TTGTTTTTCGTTCGACTCGTTGGTAATTATCTGCAGCAAGCGTTTCTATGGGAAGCTGCGTTGAATTGTGTGTATAAGATGAGGGTTTGT
GTTTTCCATAAGGTTTTGCAGAGAGATTTANGGTTCTTTGAGGGAGAAAATGGGATTGCTGCTGGAGATGTTGCTTATAGGATTACTGCC
TGA\
Edits in Original Sequence 
(5')AGGCAAAATCCXGAGTGTATGGATGTTAAGGGACCAAAACCGCAAATACCTAAATTaACCACCGGGAAATGTCCCTAATTCACCTG
AAACCGCCGTATCACGGCCGtTCGCCGCCCCTTCGCCGCCACAAACTCACAGTCCCCCGCCAGGTAACCAAACCAATTACTAACATCATC
TTCAATTTCTCCATTTCCACCTCTGCCTTAACAATAAAATCATCATCTACACGCGCCGCTGCGAACTCCGGCAAGTTCATTTCTCCGTTC
ACCTCTTTAGCTCCTCTTAAACCTTATCTCCTTTCGGAATGGAAACCGATTCTCTGTGGATGGCTCTGCAGTGTTTTATCTGTTTACTCT
CTGTCCAAAATTGTTCCCAAAGTTGGAAAATTCTCGTCTCTCATGAATCCGTTGGATGTTGTGAGGCTGAGAGAGGAGTGTTTGGTTTTG
GGAGGTTTGTTTTTCGTTCGACTCGTTGGTAATTATCTGCAGCAAGCGTTTCTATGGGAAGCTGCGTTGAATTGTGTGTATAAGATGAGG
GTTTGTGTTTTCCATAAGGTTTTGCAGAGAGATTTANGGTTCTTTGAGGGAGAAAATGGGATTGCTGCTGGAGATGTTGCTTATAGGATT
ACTGCCTGA\(3')GCTTCTGATGTTGCTGATACTGTTTATTCTCTCTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan