ESTScan Details for Unigene SGN-U280153

Score 
191
Direction 
Forward
Predicted Peptide Sequence 
QLQNFDYYSIFPIFTVSEIPNGPIGSYAEDDEIANPNSQSSPDSSPIRMLPSKSAAPKVDDTMLALTVAGEAARAQSKPLDPTQHLVGFN
PTYEQLWAPICGPAHPYAKDGLAQGLRNHKLGFVEDASIEPFVFDEQYNTFQKYGYAVDPSENSYIGDLEKMKECDAISVYNXTTA
Predicted Coding Sequence 
XCTCAGCTACAAAACTTTGATTATTACTCAATATTTCCGATTTTCACAGTATCTGAAATCCCTAATGGACCTATTGGATCCTACGCCGAG
GACGATGAAATCGCTAACCCTAATTCCCAATCTTCGCCGGATTCTTCTCCAATCCGAATGCTTCCTTCTAAATCCGCCGCCCCTAAAGTC
GACGACACCATGCTAGCCCTAACAGTCGCCGGCGAAGCTGCAAGAGCTCAGTCCAAACCCCTTGATCCGACCCAGCACCTCGTTGGATTC
AACCCGACATACGAACAACTATGGGCACCAATTTGCGGTCCAGCTCACCCGTACGCAAAGGACGGGTTAGCTCAAGGACTCAGAAATCAC
AAGCTAGGGTTCGTTGAGGACGCGTCCATTGAACCCTTTGTATTTGACGAGCAGTACAATACTTTTCAGAAGTATGGGTATGCTGTTGAT
CCCTCTGAAAATAGCTACATCGGTGATTTGGAAAAAATGAAGGAATGTGATGCAATTTCTGTGTATAACATXACCACAGCATGA\
Edits in Original Sequence 
(5')XCTCAGCTACAAAACTTTGATTATTACTCAATATTTCCGATTTTCACAGTATCTGtAAATCCCTAATGGACCTATTGcGATCCTAC
GCCGAGGACGATGAAATCGCTAACCCTAATTCCCAATCTTCGCCGGATTCTTCTCCAATCCGAATGCTTCCTTCTAAATCCGCCGCCCCT
AAAGTCGACGACACCATGCTAGCCCTAACAGTCGCCGGCGAAGCTGCAAGAGCTCAGTCCAAACCCCTTGATCCGACCCAGCACCTCGTT
GGATTCAACCCGACATACGAACAACTATGGGCACCAATTTGCGGTCCAGCTCACCCGTACGCAAAGGACGGGTTAGCTCAAGGACTCAGA
AATCACAAGCTAGGGTTCGTTGAGGACGCGTCCATTGAACCCTTTGTATTTGACGAGCAGTACAATACTTTTCAGAAGTATGGGTATGCT
GTTGATCCCTCTGAAAATAGCTACATCGGTGATTTGGAAAAAATGAAGGAATGTGATGCAATTTCTGTGTATAACATXACCACAGCATGA
\(3')ACAGAAGAAGAGGAAGTTAGAGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan