ESTScan Details for Unigene SGN-U280224

Score 
1078
Direction 
Forward
Predicted Peptide Sequence 
MGRAPCCDKNGLKKGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYLRPDIKRGRFSFEEEETIIQLHSILGNKWS
AIAARLPGRTDNEIKNYWNTHIRKRLLRMGIDPVTHSPRLDLLDXSSILNHSIYNNSSHHQMNLSRLLXHVQPLVNPESLRLATSLLSSQ
RQNSNNFLIPNNQICQNQLPQMVQSNQIQAPIQDFPTCTTISTTPCVPFSSHEAQLMQPPTTKMEDFSSNLENFSNSQNNCQVINDEWQL
SNGVTDDYFPLQNYGYYDPLTSDGSTFQSNENNNNNFNFQSVVLSNLSTPSSSPTPLNSNSTYFNNSSSTTTEDEREATAATC
Predicted Coding Sequence 
ATGGGCAGAGCTCCTTGTTGTGACAAAAATGGACTTAAAAAAGGTCCATGGACACCTGAAGAAGATCAAAAGCTCATTGATTACATTCAA
AAACATGGATATGGTAATTGGAGGACTCTTCCAAAGAATGCTGGGCTTCAAAGATGTGGAAAGAGTTGTAGGCTTCGTTGGACTAACTAT
CTAAGGCCAGATATTAAAAGAGGAAGGTTTTCTTTTGAAGAAGAAGAGACTATCATTCAACTCCACAGTATTTTAGGCAACAAGTGGTCT
GCTATTGCTGCACGTTTACCTGGTAGAACTGACAACGAAATCAAGAACTATTGGAATACACACATCAGGAAAAGGCTTTTGAGAATGGGA
ATTGATCCAGTGACACACAGTCCACGCCTTGATCTTCTTGATNCTTCTTCCATTTTAAACCATTCAATTTACAATAATTCATCTCATCAT
CAAATGAATCTTTCAAGATTGTTANGCCATGTGCAACCTTTGGTTAATCCTGAAAGTCTGAGATTAGCTACTTCTCTTTTATCATCCCAA
CGACAAAACTCAAACAACTTCTTGATCCCAAATAATCAAATTTGCCAAAACCAATTGCCACAAATGGTCCAAAGTAACCAAATTCAAGCC
CCTATTCAAGATTTTCCAACTTGCACAACTATAAGTACAACCCCATGTGTTCCATTTTCTAGTCATGAAGCTCAACTCATGCAGCCACCA
ACAACAAAAATGGAGGATTTCTCATCAAATCTTGAAAACTTTAGTAACTCACAAAATAATTGCCAAGTTATTAATGATGAGTGGCAATTA
AGCAATGGGGTAACGGATGATTATTTTCCTTTACAAAATTATGGGTACTATGATCCTCTAACATCCGATGGTTCAACATTTCAATCCAAC
GAAAACAACAACAACAATTTTAACTTCCAATCAGTTGTTTTGTCGAATTTATCGACACCTTCATCAAGTCCTACGCCATTGAATTCAAAC
TCAACTTACTTCAACAATAGCAGCAGCACAACTACTGAAGATGAAAGAGAAGCTACTGCAGCAACATGTTAA\
Edits in Original Sequence 
ATTTCTTTCTTCTCAACAAAAATATAAGACTTATAAATTACTCTCCTTGGAATCTTTTACACACACAACAAAAAAAAGAAACTACTACTA
CTCATCATCAAT
(5')ATGGGCAGAGCTCCTTGTTGTGACAAAAATGGACTTAAAAAAGGTCCATGGACACCTGAAGAAGATCAAAAGCT
CATTGATTACATTCAAAAACATGGATATGGTAATTGGAGGACTCTTCCAAAGAATGCTGGGCTTCAAAGATGTGGAAAGAGTTGTAGGCT
TCGTTGGACTAACTATCTAAGGCCAGATATTAAAAGAGGAAGGTTTTCTTTTGAAGAAGAAGAGACTATCATTCAACTCCACAGTATTTT
AGGCAACAAGTGGTCTGCTATTGCTGCACGTTTACCTGGTAGAACTGACAACGAAATCAAGAACTATTGGAATACACACATCAGGAAAAG
GCTTTTGAGAATGGGAATTGATCCAGTGACACACAGTCCACGCCTTGATCTTCTTGATNCTTCTTCCATTTTAAACCATTCAATTTACAA
TAATTCATCTCATCATCAAATGAATCTTTCAAGATTGTTANGCCATGTGCAACCTTTGGTTAATCCTGAAAGTCTGAGATTAGCTACTTC
TCTTTTATCATCCCAACGACAAAACTCAAACAACTTCTTGATCCCAAATAATCAAATTTGCCAAAACCAATTGCCACAAATGGTCCAAAG
TAACCAAATTCAAGCCCCTATTCAAGATTTTCCAACTTGCACAACTATAAGTACAACCCCATGTGTTCCATTTTCTAGTCATGAAGCTCA
ACTCATGCAGCCACCAACAACAAAAATGGAGGATTTCTCATCAAATCTTGAAAACTTTAGTAACTCACAAAATAATTGCCAAGTTATTAA
TGATGAGTGGCAATTAAGCAATGGGGTAACGGATGATTATTTTCCTTTACAAAATTATGGGTACTATGATCCTCTAACATCCGATGGTTC
AACATTTCAATCCAACGAAAACAACAACAACAATTTTAACTTCCAATCAGTTGTTTTGTCGAATTTATCGACACCTTCATCAAGTCCTAC
GCCATTGAATTCAAACTCAACTTACTTCAACAATAGCAGCAGCACAACTACTGAAGATGAAAGAGAtAGCTACTGCAGCAACATGTTAA\
(3')ACTTTGATAATATTCCAAATATTTGGGATTCTACTAATGAATTTATGTAATTTTTACTCTTTTTTTGTAAAAAAGGAACAGACAAA
CAGTTCGGAAGAGGTGTTTTTTTTTTTTTATTTACCTCTGAGCTTTTGGACATGTTGTTGTTTCCTGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan