ESTScan Details for Unigene SGN-U280240

Score 
751
Direction 
Forward
Predicted Peptide Sequence 
APQVTATHLKADARVADAFLEXDNPGGDAPCQSKRYADTINMGWRTIISLLSITARHPEASEAGFETLSFIMADGAHLLPANYILCLNAA
SHFADSRVGSVDQAVRSLDLMAGSLVCLVRWSHKTKDALGEEAAIKMSQDITXDVVEAGTGTQKVLFGLERRGGGHAILMLQRCLTVIEG
IHISTDLWLQCFDQMIFTMLDELLELAPQGSLKDYRSIEGAIFLXSEAHVQSVSTITAASLTVAILLQTMVRVTGSSERCMKMKFKGRRS
EKIPELVPELLKNTLLIMKTSGILIPSDPVGGDSFWQLTWLHVHKICPSLQSEVFPSSELEQLQKQHIQAGCSPLSEGTVLVSPS
Predicted Coding Sequence 
XXAGCTCCTCAAGTCACTGCAACTCATCTTAAAGCTGATGCAAGGGTCGCCGATGCTTTTCTTGAAXCAGATAACCCAGGAGGTGATGCA
CCTTGTCAAAGCAAACGCTATGCAGATACGATCAATATGGGCTGGAGGACAATTATATCTCTGCTTTCTATTACAGCTCGGCATCCAGAA
GCTTCTGAAGCAGGATTTGAAACACTATCATTCATCATGGCTGATGGGGCCCACCTACTGCCTGCTAATTACATCCTTTGTTTAAATGCG
GCCAGCCACTTTGCTGACTCCCGTGTTGGAAGTGTTGATCAAGCTGTGAGATCCTTAGACCTGATGGCTGGGTCACTTGTTTGTCTTGTT
AGATGGTCTCACAAGACAAAGGATGCTCTGGGGGAAGAGGCTGCTATAAAAATGTCTCAGGATATAACTGAXGATGTGGTTGAGGCTGGT
ACAGGGACTCAGAAAGTTTTGTTTGGATTGGAGAGAAGAGGTGGAGGTCATGCCATCTTGATGTTGCAGAGGTGCTTGACAGTAATTGAG
GGGATTCACATTTCAACTGATCTGTGGTTGCAGTGTTTTGATCAGATGATCTTTACAATGCTGGATGAATTGCTGGAACTTGCACCACAA
GGTTCCTTGAAGGATTACAGGAGTATTGAAGGAGCAATTTTTCTGXTCTCTGAAGCTCATGTTCAAAGTGTTTCTACAATCACTGCAGCA
TCTCTCACAGTTGCCATCCTTCTGCAAACTATGGTTAGGGTTACTGGATCATCTGAAAGATGCATGAAGATGAAATTTAAAGGTAGACGG
AGTGAGAAGATTCCAGAACTTGTCCCTGAACTCCTAAAGAACACTCTACTTATCATGAAAACTAGTGGAATTCTCATACCAAGTGATCCT
GTAGGAGGGGACAGTTTCTGGCAGCTAACGTGGTTGCATGTGCACAAAATATGTCCATCCCTTCAATCAGAAGTTTTCCCTTCTAGTGAA
TTGGAGCAGTTGCAAAAGCAGCACATTCAAGCTGGATGTAGCCCTCTCTCAGAGGGAACTGTTCTAGTCTCACCTAGTTAA\
Edits in Original Sequence 
(5')XXAGCTCCTCAAGTCACTGCAACTCATCTTAAAGCTcGATGCAAGGGTCGCCGATGCTTTTCTTGAAXCAGATAACCCAGGAGGTG
ATGCACCTTGTCAAAGCAAACGCTATGCAGATACGATCtAATATGGGCTGGAGGACAATTATATCTCTGCTTTCTATTACAGCTCGGCAT
CCAGAAGCTTCTGAAGCAGGATTTGAAACACTATCATTCATCATGGCTGATGGGGCCCACCTACTGCCTGCTAATTACATCCTTTGTTTA
AATGCGGCCAGCCACTTTGCTGACTCCCGTGTTGGAAGTGTTGATCAAGCTGTGAGATCCTTAGACCTGATGGCTGGGTCACTTGTTTGT
CTTGTTAGATGGTCTCACAAGACAAAGGATGCTCTGGGGGAAGAGGCTGCTATAAAAATGTCTCAGGATATAACTGAXGATGTGGTTGAG
GCTGGTACAGGGACTCAGAAAGTTTTGTTTGGATTGGAGAGAAGAGGTGcGAGGTCATGCCATCTTGATGTTGCAGAGGTGCTTGACAGT
AATTGAGGGGATTCACATTTCAACTGATCTGTGGTTGCAGTGTTTTGATCAGATGATCTTTACAATGCTGGATGAATTGCTGGAACTTGC
ACCACAAGGTTCCTTGAAGGATTACAGGAGTATTGAAGGAGCAATTTTTCTGXTCTCTGAAGCTCATGTTCAAAGTGTTTCTACAATCAC
TGCAGCATCTCTCACAGTTGCCATCCTTCTGCAAACTATGGTTAGGGTTACTGGATCATaCTGAAAGATGCATGAAGATGAAATTTAAAG
GTAGACGGAGTGAGAAGATTCCAGAACTTGTCCCTGAACTCCTAAAGAACACTCTACTTATCATGAAAACTAGTGGAATTCTCATACCAA
GTGATCCTGTAGGAGGGGACAGTTTCTGGCAGCTAACGTGGTTGCATGTGCACAAAATATGTCCATCCCTTCAATCAGAAGTTTTCCCTT
CTAGTGAATTGGAGCAGTTGCAAAAGCAGCACATTCAAGCTGGATGTAGCCCTCTCTCAGAGGGAACTGTTCTAGTCTCACCTAGTTAA\
(3')AACACATACTGAAGATTCATGCTNGTTGACACACTTTCATTTGGTGAAACTGACATTCTTATCCATCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan