ESTScan Details for Unigene SGN-U280562

Score 
307
Direction 
Reverse
Predicted Peptide Sequence 
MANSLMPIVDLSPFFLGDEDGERKAREVIHEACSRYGFFQIVNHGVPLDLMSRALKLSKSFFECPVEEKMNCSPLPGAPFPAGYNRKPNP
SYEFAEYLVMLHPGSTFNVFPF
Predicted Coding Sequence 
ATGGCTAATTCACTGATGCCAATAGTTGATCTTTCCCCGTTCTTTCTAGGAGATGAAGATGGCGAGAGAAAGGCAAGAGAAGTGATACAC
GAAGCATGTAGTCGATATGGCTTCTTCCAAATTGTCAATCATGGGGTGCCTTTGGACCTTATGAGCCGTGCCTTAAAACTATCAAAGTCC
TTTTTCGAGTGTCCTGTTGAAGAGAAAATGAACTGCTCTCCATTGCCAGGGGCGCCTTTTCCTGCAGGCTATAACAGAAAACCAAATCCG
TCTTATGAATTTGCAGAGTACTTGGTTATGCTTCACCCCGGATCCACCTTCAATGTTTTTCCTTTTTGA\
Edits in Original Sequence 
TAATAGTAATATGTGGTGAAATCACGTGAAGTTGATAAATTGAAGGATTTATGTGACGTGGTTATGTCCCTTTTCTATGGGGAGTTAAAT
TATTTGATTTAATTAATCTGTAACCATACTTATCCTTTTTTATAATGTTAATCATCAACCAAAAACACAGGTATCTAGATAATAACTACT
TAAAAAGCCACCATTTTGTTTGTAATCTTGTACTAATAAGATTTTTCTTAGCCATATTGAATGTTGTAAAGCAAC
(5')ATGGCTAATTC
ACTGATGCCAATAGTTGATCTTTCCCCGTTCTTTCTAGGAGATGAAGATGGCGAGAGAAAGGCAAGAGAAGTGATACACGAAGCATGTAG
TCGATATGGCTTCTTCCAAATTGTCAATCATGGGGTGCCTTTGGACCTTATGAGCCGTGCCTTAAAACTATCAAAGTCCTTTTTCGAGTG
TCCTGTTGAAGAGAAAATGAACTGCTCTCCATTGCCAGGGGCGCCTTTTCCTGCAGGCTATAACAGAAAACCAAATCCGTCTTATGAATT
TGCAGAGTACTTGGTTATGCTTCACCCCGGATCCACCTTCAATGTTTTTCCTTTTTGA\(3')GTGATCTGATTGTGTAAATATTGAACT
TAAAATCACACTTCTAGTTATCTCATTTTTGCCAAAATAGCTATCAAACTTTTCCAACAGTCATCCAAGTTTTCATATTCTCTGCTATCT
AATGATTCTTGTACTAAATTATTTGTTGAGAACCTTTACATCTTTAAAAATTTATGACAGAGCTATCCAGAAAATGAATATTATTATATG
GCCATATGGGGTAGAACAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan