ESTScan Details for Unigene SGN-U280566

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
VKLLNILGALIPGGEVVVTITGERFAAERELNADLMGENSSVTAAPPPSLEKTSAIEDALLKQFFAEVSEVERDNEVIRILSCFKLNPFE
YLNLSFDSSIGEVKKQYRKLSLLVHPDKCKHPQAKEAFGXTKAQQLLLDQQERDYILSQVVAAKGSPSPRYSFFCSLVFLSPWDRLHSHS
LCISNGALKLLLQFFSGLSSTKIGIKIKVEEAAKKDTARKLKSLVTEGKYDQEHEQSEEFQQQLKVX
Predicted Coding Sequence 
GTTAAGCTXCTGAACATTTTGGGAGCTCTCATCCCCGGTGGCGAAGTGGTTGTTACTATAACAGGAGAGAGATTCGCAGCGGAGCGTGAA
CTCAACGCTGATTTGATGGGAGAAAATAGCTCTGTCACCGCCGCACCACCTCCGTCGTTGGAAAAAACCTCCGCCATCGAGGACGCGCTT
CTCAAGCAATTCTTCGCTGAGGTCAGCGAGGTTGAGCGCGACAACGAAGTTATAAGGATACTTTCATGCTTCAAGTTGAATCCATTTGAA
TACCTTAACCTGTCATTTGATTCATCCATTGGCGAAGTTAAAAAGCAGTATCGTAAGTTGTCTTTACTTGTTCACCCTGATAAATGCAAG
CATCCACAAGCAAAGGAGGCATTTGGTGXTACTAAAGCGCAACAGTTATTACTTGATCAACAGGAGAGGGATTACATTCTGAGCCAAGTT
GTTGCAGCAAAAGGTTCGCCATCACCTCGCTATTCATTCTTTTGTTCTTTAGTCTTCCTTTCGCCATGGGATAGACTGCATTCACATTCT
CTCTGCATTTCCAATGGAGCACTAAAACTGTTGCTGCAATTCTTCAGTGGTCTGAGTTCAACAAAAATAGGAATTAAGATCAAAGTGGAA
GAAGCAGCTAAAAAAGATACTGCTAGGAAATTGAAGTCATTAGTTACTGAGGGTAAATATGACCAAGAACATGAGCAGTCAGAGGAATTC
CAGCAGCAGCTGAAAGTTAXX\
Edits in Original Sequence 
(5')GTTAAGCTXCTGAACATTTTGGGAGCTCTCATCCCCGGTGGCGAAGTGGTTGTTACgTATAACAGGAGAGAGATTCGCAGCGGAGC
GTGAACTCAACGCgTGATTTGATGGGAGAAAATAGCTCTGTCACCGCCGCACCACCTCCGTCGTTGGAAAAAACCTCCGCCATCGAGGAC
GCGCTTCTCAAGCAATTCTTCGCTGAGGTCAGCGAGGTTGAGCGCGACAACGAAGTTATAAGGATACTTTCATGCTTCAAGTTGAATCCA
TTTGAATACCTTAACCTGTCATTTGATTCATCCATTGGCGAAGTTAAAAAGCAGTATCGTAAGTTGTCTTTACTTGTTCACCCTGATAAA
TGCAAGCATCCACAAGCAAAGGAGGCATTTGGTGXTACTAAAGCGCAACAGTTATTACTTGATCAACAGGAGAGGGATTACATTCTGAGC
CAAGTTGTTGCAGCAAAAGGTTCGCCATCACCTCGCTATTCATTCTTTTGTTCTTTAGTCTTCCTTTCGCCATGGGATAGACTGCATTCA
CATTCTCTCTGCATTTCCAATGGAGCACTAAAACTGTTGCTGCAATTCTTCAGTGGTCTGAGTTCAACAAAAATAGGAATTAAGATCAAA
GTGGAAGAAGCAGCtTAAAAAAGATACTGCTAGGAAATTGAAGTCATTAGTTACTGAGGGTAAATATGACCAAGAACATGAGCAGTCAGA
GGAATTCCAGCAGCAGCTGAAAGTTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan